BLASTX nr result
ID: Astragalus22_contig00033651
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033651 (527 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012572334.1| PREDICTED: exonuclease 1 isoform X2 [Cicer a... 94 5e-19 ref|XP_004504251.1| PREDICTED: exonuclease 1 isoform X1 [Cicer a... 94 5e-19 dbj|GAU18778.1| hypothetical protein TSUD_80670 [Trifolium subte... 89 3e-17 gb|PNY06175.1| exonuclease 1-like protein [Trifolium pratense] 85 7e-16 ref|XP_013446674.1| 5'-3' exonuclease family protein [Medicago t... 84 2e-15 ref|XP_003629884.2| 5'-3' exonuclease family protein [Medicago t... 78 1e-13 ref|XP_020204265.1| exonuclease 1 [Cajanus cajan] 58 2e-06 >ref|XP_012572334.1| PREDICTED: exonuclease 1 isoform X2 [Cicer arietinum] Length = 717 Score = 94.0 bits (232), Expect = 5e-19 Identities = 44/61 (72%), Positives = 47/61 (77%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTKTRRIAPDIHKTSNNRPTAVDFSQYAYAPK 181 RAPL +V NTRNNRPTA SQ+A VPK TKTRR AP IH T NNRPTA D SQYAY PK Sbjct: 653 RAPLNDVRNTRNNRPTAVDLSQYAYVPKPTKTRRTAPGIHNTRNNRPTAADLSQYAYVPK 712 Query: 182 E 184 + Sbjct: 713 Q 713 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 113 DIHKTSNNRPTAVDFSQYAYAPKETKTRRMAPG 211 D+ T NNRPTAVD SQYAY PK TKTRR APG Sbjct: 658 DVRNTRNNRPTAVDLSQYAYVPKPTKTRRTAPG 690 >ref|XP_004504251.1| PREDICTED: exonuclease 1 isoform X1 [Cicer arietinum] Length = 721 Score = 94.0 bits (232), Expect = 5e-19 Identities = 44/61 (72%), Positives = 47/61 (77%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTKTRRIAPDIHKTSNNRPTAVDFSQYAYAPK 181 RAPL +V NTRNNRPTA SQ+A VPK TKTRR AP IH T NNRPTA D SQYAY PK Sbjct: 657 RAPLNDVRNTRNNRPTAVDLSQYAYVPKPTKTRRTAPGIHNTRNNRPTAADLSQYAYVPK 716 Query: 182 E 184 + Sbjct: 717 Q 717 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +2 Query: 113 DIHKTSNNRPTAVDFSQYAYAPKETKTRRMAPG 211 D+ T NNRPTAVD SQYAY PK TKTRR APG Sbjct: 662 DVRNTRNNRPTAVDLSQYAYVPKPTKTRRTAPG 694 >dbj|GAU18778.1| hypothetical protein TSUD_80670 [Trifolium subterraneum] Length = 698 Score = 89.0 bits (219), Expect = 3e-17 Identities = 41/61 (67%), Positives = 46/61 (75%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTKTRRIAPDIHKTSNNRPTAVDFSQYAYAPK 181 RAPLK+V NTRNNRP A F+Q A VPK TKTRR+APD T RPTAVD +QYAY PK Sbjct: 634 RAPLKDVRNTRNNRPAAVDFNQFAYVPKPTKTRRVAPDTRNTRKTRPTAVDLNQYAYVPK 693 Query: 182 E 184 + Sbjct: 694 Q 694 >gb|PNY06175.1| exonuclease 1-like protein [Trifolium pratense] Length = 643 Score = 84.7 bits (208), Expect = 7e-16 Identities = 42/68 (61%), Positives = 47/68 (69%), Gaps = 7/68 (10%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTK-------TRRIAPDIHKTSNNRPTAVDFS 160 RAPLK+V NTRNNRP A FSQ A VPK TK TRR+APD H T RPTAVD + Sbjct: 572 RAPLKDVRNTRNNRPAAVDFSQFAYVPKPTKTQRVAPDTRRVAPDTHNTRKTRPTAVDLN 631 Query: 161 QYAYAPKE 184 Q+AY PK+ Sbjct: 632 QFAYVPKQ 639 >ref|XP_013446674.1| 5'-3' exonuclease family protein [Medicago truncatula] gb|KEH20701.1| 5'-3' exonuclease family protein [Medicago truncatula] Length = 721 Score = 83.6 bits (205), Expect = 2e-15 Identities = 38/61 (62%), Positives = 45/61 (73%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTKTRRIAPDIHKTSNNRPTAVDFSQYAYAPK 181 RAPLK+V NT N RP A SQ+A VPK TKTRR+APD+ T N RP AVD +Q+AY PK Sbjct: 657 RAPLKDVRNTHNKRPAAVDLSQYAYVPKPTKTRRVAPDVRNTRNIRPKAVDLNQFAYVPK 716 Query: 182 E 184 + Sbjct: 717 Q 717 >ref|XP_003629884.2| 5'-3' exonuclease family protein [Medicago truncatula] gb|AET04360.2| 5'-3' exonuclease family protein [Medicago truncatula] Length = 735 Score = 78.2 bits (191), Expect = 1e-13 Identities = 36/57 (63%), Positives = 42/57 (73%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTKTRRIAPDIHKTSNNRPTAVDFSQYAY 172 RAPLK+V NT N RP A SQ+A VPK TKTRR+APD+ T N RP AVD +Q+AY Sbjct: 663 RAPLKDVRNTHNKRPAAVDLSQYAYVPKPTKTRRVAPDVRNTRNIRPKAVDLNQFAY 719 >ref|XP_020204265.1| exonuclease 1 [Cajanus cajan] Length = 742 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = +2 Query: 113 DIHKTSNNRPTAVDFSQYAYAPKETKTRRMAPGN 214 D+ TS+NRP VDF QYAY PK+TKTRR+APGN Sbjct: 709 DVQNTSDNRPKTVDFGQYAYVPKQTKTRRIAPGN 742 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/37 (70%), Positives = 29/37 (78%) Frame = +2 Query: 2 RAPLKEVHNTRNNRPTAAKFSQHANVPKQTKTRRIAP 112 RAPLK+V NT +NRP F Q+A VPKQTKTRRIAP Sbjct: 704 RAPLKDVQNTSDNRPKTVDFGQYAYVPKQTKTRRIAP 740