BLASTX nr result
ID: Astragalus22_contig00033615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033615 (394 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAU03730.1| hypothetical protein VIGAN_UM165500, partial [Vi... 52 5e-06 >dbj|BAU03730.1| hypothetical protein VIGAN_UM165500, partial [Vigna angularis var. angularis] Length = 87 Score = 51.6 bits (122), Expect = 5e-06 Identities = 21/40 (52%), Positives = 28/40 (70%) Frame = -1 Query: 121 GWVYDRLYPGRAGLKPHFVVGVEEFIMVANQHKLTEFEGG 2 GW+YDR Y GR GLK FV+GVEEF+ A +++ +GG Sbjct: 29 GWMYDRCYSGRRGLKESFVIGVEEFVETARRYQYYALDGG 68