BLASTX nr result
ID: Astragalus22_contig00033404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033404 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE50547.1| hypothetical protein CFP56_00011 [Quercus suber] 43 9e-06 >gb|POE50547.1| hypothetical protein CFP56_00011 [Quercus suber] Length = 367 Score = 43.1 bits (100), Expect(2) = 9e-06 Identities = 24/76 (31%), Positives = 43/76 (56%) Frame = -2 Query: 342 EPLIFASTNNVALARKSLVGRVLASKLLNKNDVKDILSKAWSN**DLHIFDHGGFNKYIF 163 +PL+ +N + L+G++L+ K+ K VK+IL+KAW+ D+ + N YIF Sbjct: 32 DPLVQEKSNRL------LIGKILSKKVFPKPLVKEILTKAWNIVNDIEV-SVADKNVYIF 84 Query: 162 YFSHELQAKEVFQKAP 115 F+HE + + + + P Sbjct: 85 SFAHEAKLRRAWDRRP 100 Score = 33.9 bits (76), Expect(2) = 9e-06 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = -1 Query: 139 QRSFPKSPHVRYESLLCLQYWIHEASTVELDFIENLFWIQVHNLPL 2 +R++ + P + L L+ + S E+DF FWIQVH LPL Sbjct: 93 RRAWDRRPWIVKGDPLILKCFNSNLSIAEVDFSTTEFWIQVHGLPL 138