BLASTX nr result
ID: Astragalus22_contig00033226
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00033226 (301 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU26681.1| hypothetical protein TSUD_314580 [Trifolium subt... 49 6e-08 ref|XP_003603234.1| pentatricopeptide (PPR) repeat protein [Medi... 47 1e-06 >dbj|GAU26681.1| hypothetical protein TSUD_314580 [Trifolium subterraneum] Length = 715 Score = 48.9 bits (115), Expect(2) = 6e-08 Identities = 28/47 (59%), Positives = 29/47 (61%), Gaps = 17/47 (36%) Frame = -1 Query: 301 MFGQMKEV-----------------EECSLRLFIDLLRSDLLPDQYS 212 MFGQMKEV EECSLRLFIDLLRS LLPDQY+ Sbjct: 369 MFGQMKEVDLISWNTVISGCAQSGLEECSLRLFIDLLRSGLLPDQYT 415 Score = 35.4 bits (80), Expect(2) = 6e-08 Identities = 16/28 (57%), Positives = 22/28 (78%) Frame = -3 Query: 215 FTFASVLKDCSSLKDIKDSYCLDMQIHT 132 +T+ASVL+ CSSL ++SYCL Q+HT Sbjct: 414 YTYASVLRACSSL---EESYCLGRQVHT 438 >ref|XP_003603234.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] gb|AES73485.1| pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 973 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 27/47 (57%), Positives = 29/47 (61%), Gaps = 17/47 (36%) Frame = -1 Query: 301 MFGQMKEV-----------------EECSLRLFIDLLRSDLLPDQYS 212 MFGQMKEV EECSLRLFIDLLRS LLPDQ++ Sbjct: 354 MFGQMKEVDLISWNTVISGCARSGLEECSLRLFIDLLRSGLLPDQFT 400 Score = 32.7 bits (73), Expect(2) = 1e-06 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = -3 Query: 215 FTFASVLKDCSSLKDIKDSYCLDMQIHT 132 FT SVL+ CSSL ++SYC+ Q+HT Sbjct: 399 FTITSVLRACSSL---EESYCVGRQVHT 423