BLASTX nr result
ID: Astragalus22_contig00032803
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00032803 (336 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012570487.1| PREDICTED: pentatricopeptide repeat-containi... 74 6e-13 dbj|GAU47920.1| hypothetical protein TSUD_13900 [Trifolium subte... 64 2e-09 gb|PNY15589.1| pentatricopeptide repeat-containing protein at3g2... 62 9e-09 >ref|XP_012570487.1| PREDICTED: pentatricopeptide repeat-containing protein At3g23020-like [Cicer arietinum] Length = 825 Score = 73.9 bits (180), Expect = 6e-13 Identities = 37/56 (66%), Positives = 42/56 (75%) Frame = +1 Query: 169 MLVRLQLLYTNTLALPAPRENSAPIFIPSSKTSQQQPLPHFPNSTDPKSPLKKLNL 336 ML+ LQLL TNTL L PREN+ PI IPS KT+QQQ LPH P+ TD +S KKLNL Sbjct: 1 MLLNLQLLDTNTLPLVVPRENAVPISIPSKKTTQQQSLPHSPDGTDSESRFKKLNL 56 >dbj|GAU47920.1| hypothetical protein TSUD_13900 [Trifolium subterraneum] Length = 816 Score = 63.5 bits (153), Expect = 2e-09 Identities = 35/50 (70%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 190 LYTNTLAL-PAPRENSAPIFIPSSKTSQQQPLPHFPNSTDPKSPLKKLNL 336 L TNTLAL APRENS PI IP+ KT+QQQPLPH PN T P+S KK NL Sbjct: 5 LETNTLALVAAPRENSLPISIPT-KTTQQQPLPHSPNDTHPESRFKKFNL 53 >gb|PNY15589.1| pentatricopeptide repeat-containing protein at3g23020-like protein [Trifolium pratense] Length = 829 Score = 62.0 bits (149), Expect = 9e-09 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = +1 Query: 190 LYTNTLAL-PAPRENSAPIFIPSSKTSQQQPLPHFPNSTDPKSPLKKLNL 336 L TNTLAL PRE S PI IP+ KT+QQQPLPH PN TDP+S KK NL Sbjct: 5 LDTNTLALVTVPREKSLPISIPT-KTTQQQPLPHSPNDTDPESRFKKFNL 53