BLASTX nr result
ID: Astragalus22_contig00032350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00032350 (682 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN37718.1| Putative DNA-directed RNA polymerase I subunit RP... 57 8e-06 >gb|KHN37718.1| Putative DNA-directed RNA polymerase I subunit RPA2 [Glycine soja] Length = 326 Score = 56.6 bits (135), Expect = 8e-06 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 2/46 (4%) Frame = +1 Query: 22 SLRELFRAHIESFDHMIETGLPEMCRHIKPVVIVQD--STELRNIL 153 +LRELF+ HIESFD+M++ GL M HIKPV I D ST+LRNIL Sbjct: 13 ALRELFKHHIESFDYMVDAGLDTMLGHIKPVEIFDDFTSTKLRNIL 58