BLASTX nr result
ID: Astragalus22_contig00032259
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00032259 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017416742.1| PREDICTED: uncharacterized protein LOC108327... 66 1e-11 dbj|BAT85418.1| hypothetical protein VIGAN_04296200, partial [Vi... 66 2e-11 gb|KRH67170.1| hypothetical protein GLYMA_03G151600 [Glycine max] 66 5e-11 ref|XP_007162403.1| hypothetical protein PHAVU_001G149100g [Phas... 65 7e-11 ref|XP_020213940.1| uncharacterized protein LOC109798126 [Cajanu... 62 4e-10 ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659... 62 4e-10 ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phas... 62 4e-10 gb|KYP71562.1| hypothetical protein KK1_010826, partial [Cajanus... 62 5e-10 ref|XP_020991586.1| uncharacterized protein LOC110278051 [Arachi... 61 1e-09 ref|XP_021681344.1| uncharacterized protein LOC110665494 [Hevea ... 59 5e-09 gb|OAY49672.1| hypothetical protein MANES_05G073900 [Manihot esc... 59 5e-09 ref|XP_018503043.1| PREDICTED: uncharacterized protein LOC108867... 59 7e-09 ref|XP_016725142.1| PREDICTED: uncharacterized protein LOC107936... 59 9e-09 ref|XP_014512092.1| uncharacterized protein LOC106770798 [Vigna ... 59 9e-09 gb|PNT04726.1| hypothetical protein POPTR_014G138900v3 [Populus ... 58 1e-08 ref|XP_020959379.1| uncharacterized protein LOC110263093 [Arachi... 58 2e-08 gb|OAY61692.1| hypothetical protein MANES_01G209600 [Manihot esc... 58 2e-08 ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Popu... 58 2e-08 ref|XP_015583230.1| PREDICTED: uncharacterized protein LOC107262... 57 2e-08 ref|XP_020425748.1| uncharacterized protein LOC18766299 [Prunus ... 57 3e-08 >ref|XP_017416742.1| PREDICTED: uncharacterized protein LOC108327562 [Vigna angularis] Length = 48 Score = 65.9 bits (159), Expect = 1e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RP RCSKYIRQQ+TR+YIIWRCT LLLCWHE Sbjct: 17 RPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHE 48 >dbj|BAT85418.1| hypothetical protein VIGAN_04296200, partial [Vigna angularis var. angularis] Length = 70 Score = 65.9 bits (159), Expect = 2e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RP RCSKYIRQQ+TR+YIIWRCT LLLCWHE Sbjct: 39 RPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHE 70 >gb|KRH67170.1| hypothetical protein GLYMA_03G151600 [Glycine max] Length = 102 Score = 65.9 bits (159), Expect = 5e-11 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RP RCSKYIRQQ+TR+YIIWRCT LLLCWHE Sbjct: 71 RPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHE 102 >ref|XP_007162403.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] gb|ESW34397.1| hypothetical protein PHAVU_001G149100g [Phaseolus vulgaris] Length = 70 Score = 64.7 bits (156), Expect = 7e-11 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RP RCSKYIRQQ+TR+YIIWRCT LLLCWH+ Sbjct: 39 RPWGRCSKYIRQQRTRLYIIWRCTVLLLCWHD 70 >ref|XP_020213940.1| uncharacterized protein LOC109798126 [Cajanus cajan] Length = 45 Score = 62.0 bits (149), Expect = 4e-10 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R ERCSK +RQQ+TR+YIIWRCT LLLCWHE Sbjct: 14 RSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_006588622.1| PREDICTED: uncharacterized protein LOC102659834 [Glycine max] gb|KRH31994.1| hypothetical protein GLYMA_10G024900 [Glycine max] Length = 45 Score = 62.0 bits (149), Expect = 4e-10 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R ERCSK +RQQ+TR+YIIWRCT LLLCWHE Sbjct: 14 RSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >ref|XP_007144608.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] gb|ESW16602.1| hypothetical protein PHAVU_007G169700g [Phaseolus vulgaris] Length = 45 Score = 62.0 bits (149), Expect = 4e-10 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R ERCSK +RQQ+TR+YIIWRCT LLLCWHE Sbjct: 14 RSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 45 >gb|KYP71562.1| hypothetical protein KK1_010826, partial [Cajanus cajan] Length = 55 Score = 62.0 bits (149), Expect = 5e-10 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R ERCSK +RQQ+TR+YIIWRCT LLLCWHE Sbjct: 24 RSWERCSKQVRQQRTRLYIIWRCTVLLLCWHE 55 >ref|XP_020991586.1| uncharacterized protein LOC110278051 [Arachis duranensis] Length = 45 Score = 60.8 bits (146), Expect = 1e-09 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R ERCSK +RQQ+TR+YIIWRCT LLLCWH+ Sbjct: 14 RSWERCSKQVRQQRTRLYIIWRCTVLLLCWHD 45 >ref|XP_021681344.1| uncharacterized protein LOC110665494 [Hevea brasiliensis] Length = 45 Score = 59.3 bits (142), Expect = 5e-09 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R +RCSK IR+Q+TR+YIIWRCT +LLCWHE Sbjct: 14 RSWQRCSKQIREQRTRLYIIWRCTVMLLCWHE 45 >gb|OAY49672.1| hypothetical protein MANES_05G073900 [Manihot esculenta] Length = 47 Score = 59.3 bits (142), Expect = 5e-09 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R +RCSK IR+Q+TR+YIIWRCT +LLCWHE Sbjct: 16 RSWQRCSKQIREQRTRLYIIWRCTVMLLCWHE 47 >ref|XP_018503043.1| PREDICTED: uncharacterized protein LOC108867256 [Pyrus x bretschneideri] Length = 52 Score = 58.9 bits (141), Expect = 7e-09 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RP RCSK IR+Q+ R+YIIWRCT +LLCWHE Sbjct: 21 RPWGRCSKQIREQRARLYIIWRCTVMLLCWHE 52 >ref|XP_016725142.1| PREDICTED: uncharacterized protein LOC107936876 [Gossypium hirsutum] Length = 45 Score = 58.5 bits (140), Expect = 9e-09 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R ERCSK IR+Q+ R+YIIWRCT LLLCWHE Sbjct: 14 RTWERCSKQIREQRGRLYIIWRCTVLLLCWHE 45 >ref|XP_014512092.1| uncharacterized protein LOC106770798 [Vigna radiata var. radiata] Length = 45 Score = 58.5 bits (140), Expect = 9e-09 Identities = 22/28 (78%), Positives = 26/28 (92%) Frame = +1 Query: 130 RCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RCSK +RQQ+TR+YIIWRCT LLLCWH+ Sbjct: 18 RCSKQVRQQRTRLYIIWRCTVLLLCWHD 45 >gb|PNT04726.1| hypothetical protein POPTR_014G138900v3 [Populus trichocarpa] Length = 45 Score = 58.2 bits (139), Expect = 1e-08 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R +RCSK IR+Q+TR+YIIWRCT +LLCWH+ Sbjct: 14 RSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 45 >ref|XP_020959379.1| uncharacterized protein LOC110263093 [Arachis ipaensis] Length = 43 Score = 57.8 bits (138), Expect = 2e-08 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 124 KERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 + RCSKYIRQQ+TR+YIIWRCT LLLC H+ Sbjct: 14 RRRCSKYIRQQRTRLYIIWRCTVLLLCCHD 43 >gb|OAY61692.1| hypothetical protein MANES_01G209600 [Manihot esculenta] Length = 45 Score = 57.8 bits (138), Expect = 2e-08 Identities = 21/32 (65%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R +RCSK +R+Q+TR+YIIWRCT +LLCWH+ Sbjct: 14 RSWQRCSKQVREQRTRLYIIWRCTVMLLCWHD 45 >ref|XP_002320393.1| hypothetical protein POPTR_0014s13500g [Populus trichocarpa] gb|PNT04727.1| hypothetical protein POPTR_014G138900v3 [Populus trichocarpa] Length = 64 Score = 58.2 bits (139), Expect = 2e-08 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R +RCSK IR+Q+TR+YIIWRCT +LLCWH+ Sbjct: 33 RSWQRCSKQIREQRTRLYIIWRCTVMLLCWHD 64 >ref|XP_015583230.1| PREDICTED: uncharacterized protein LOC107262365 [Ricinus communis] Length = 45 Score = 57.4 bits (137), Expect = 2e-08 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 R RCSK IR+Q+TR+YIIWRCT +LLCWH+ Sbjct: 14 RSWHRCSKQIREQRTRLYIIWRCTVMLLCWHD 45 >ref|XP_020425748.1| uncharacterized protein LOC18766299 [Prunus persica] Length = 49 Score = 57.4 bits (137), Expect = 3e-08 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = +1 Query: 118 RPKERCSKYIRQQKTRVYIIWRCTALLLCWHE 213 RP RCSK+IR+Q+ R+YI+WRC+ +LLCWH+ Sbjct: 18 RPWTRCSKHIREQRARLYIVWRCSVMLLCWHD 49