BLASTX nr result
ID: Astragalus22_contig00032091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00032091 (397 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_042512.1| hypothetical protein [Peanut chlorotic streak v... 59 2e-07 ref|NP_861409.1| putative capsid protein [Cestrum yellow leaf cu... 57 1e-06 ref|NP_068728.1| putative coat protein [Soybean chlorotic mottle... 56 2e-06 ref|YP_009254007.1| putative coat protein [Water chestnut soymov... 55 4e-06 ref|XP_016752739.1| PREDICTED: uncharacterized protein LOC107961... 55 4e-06 >ref|NP_042512.1| hypothetical protein [Peanut chlorotic streak virus] gb|AAA50239.1| putative major capsid protein [Peanut chlorotic streak virus] Length = 462 Score = 58.5 bits (140), Expect = 2e-07 Identities = 24/68 (35%), Positives = 45/68 (66%), Gaps = 2/68 (2%) Frame = +3 Query: 9 RHGFKSGDKPYKRNFRRKWFNREKYKKKGYNRAVKSCTCFLCKEEGHYANQCPKR--NKQ 182 ++ ++ Y+ RRK +++++ K+K R K+C C++C+EEGHYAN+CP R N++ Sbjct: 354 KYPYRKWKPKYRYKVRRKGYSKQQNKQKTCPRGKKTCRCWICQEEGHYANECPNRKINQK 413 Query: 183 NIKALRII 206 K +R++ Sbjct: 414 KDKYVRML 421 >ref|NP_861409.1| putative capsid protein [Cestrum yellow leaf curling virus] sp|Q7TD09.1|CAPSD_CYLCV RecName: Full=Capsid protein; Short=CP; AltName: Full=coat protein gb|AAP78923.1| putative capsid protein [Cestrum yellow leaf curling virus] Length = 501 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/57 (47%), Positives = 37/57 (64%), Gaps = 4/57 (7%) Frame = +3 Query: 33 KPYKRNFRRKWFNREKY----KKKGYNRAVKSCTCFLCKEEGHYANQCPKRNKQNIK 191 K KR F+R+ F+++K KKK KSC C++C EEGHYAN+CPK+ K+ K Sbjct: 399 KKKKRFFKRRDFSKKKKENPGKKKFCPTGKKSCKCWICHEEGHYANECPKKTKEKHK 455 >ref|NP_068728.1| putative coat protein [Soybean chlorotic mottle virus] sp|P15627.2|CAPSD_SOCMV RecName: Full=Capsid protein; Short=CP; AltName: Full=Coat protein emb|CAC16944.1| putative coat protein [Soybean chlorotic mottle virus] Length = 441 Score = 56.2 bits (134), Expect = 2e-06 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 10/83 (12%) Frame = +3 Query: 3 KSRHGFKSGDKPYKRNFRRKWFNREKYK----KKGYNR------AVKSCTCFLCKEEGHY 152 K + F+ K K+NF KW N+ K K K+ + + K C C+LC EEGHY Sbjct: 334 KPKKKFRKIKKYPKKNFW-KWNNQRKKKTFRKKRPFRKQQTCPTGKKKCQCWLCHEEGHY 392 Query: 153 ANQCPKRNKQNIKALRIIDDNSF 221 AN+CPK++ + + L++I D F Sbjct: 393 ANECPKKDNKKAQTLKLIFDLGF 415 >ref|YP_009254007.1| putative coat protein [Water chestnut soymovirus 1] gb|AND65751.1| putative coat protein [Water chestnut soymovirus 1] Length = 478 Score = 55.1 bits (131), Expect = 4e-06 Identities = 27/77 (35%), Positives = 46/77 (59%), Gaps = 4/77 (5%) Frame = +3 Query: 3 KSRHGFKSGDKPYKRNFRRKWFNREKYKKKGYN--RAVKSCTCFLCKEEGHYANQCPKR- 173 K+ H K+ KP+K ++ K+F + + ++ N K+C C+LC++EGHYAN+CP++ Sbjct: 366 KNFHKIKTYKKPWKPKYK-KYFKKRRMSERQRNCPSKKKNCKCWLCQKEGHYANECPEKQ 424 Query: 174 -NKQNIKALRIIDDNSF 221 + +K L I D F Sbjct: 425 LKRNQVKQLEEIQDLGF 441 >ref|XP_016752739.1| PREDICTED: uncharacterized protein LOC107961006 [Gossypium hirsutum] Length = 581 Score = 55.1 bits (131), Expect = 4e-06 Identities = 32/87 (36%), Positives = 44/87 (50%), Gaps = 28/87 (32%) Frame = +3 Query: 33 KPYKRNFRRKWFNREKYK----KKGYN--------------------RAVKSCTCFLCKE 140 K YK+ +RRK + ++ K KK Y+ R K C C+LCKE Sbjct: 454 KKYKKQYRRKRYKKDNKKGHRRKKSYDELRDNHYENRDKIRKQQDCPRKKKDCRCWLCKE 513 Query: 141 EGHYANQCPKRNKQN----IKALRIID 209 EGHYAN+CP+R+K+ IK L I+ Sbjct: 514 EGHYANECPQRHKRENNRMIKQLEYIN 540