BLASTX nr result
ID: Astragalus22_contig00032058
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00032058 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX71307.1| ABC transporter C family member 5-like protein [T... 69 4e-10 ref|XP_003625394.2| ABC transporter-like family-protein [Medicag... 64 1e-08 ref|XP_012569380.1| PREDICTED: ABC transporter C family member 5... 61 1e-07 >gb|PNX71307.1| ABC transporter C family member 5-like protein [Trifolium pratense] Length = 699 Score = 68.6 bits (166), Expect = 4e-10 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -1 Query: 154 NTLLNAILELPILELVAICVNLTILILFLGRKVFVCVVGERVRFYKDNNN 5 NTLL+ ILELP+LELVAI NL +L+LFL R+VF+C VG RV F+KDNNN Sbjct: 13 NTLLSKILELPVLELVAIFTNLVLLVLFLLREVFIC-VGGRVWFFKDNNN 61 >ref|XP_003625394.2| ABC transporter-like family-protein [Medicago truncatula] gb|AES81612.2| ABC transporter-like family-protein [Medicago truncatula] Length = 1514 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = -1 Query: 154 NTLLNAILELPILELVAICVNLTILILFLGRKVFVCVVGERVRFYKDNNNN 2 NTL + IL LP+LELVAIC NL +L+LFL R+ F C VG RV F KDN+NN Sbjct: 20 NTLFSKILGLPVLELVAICTNLAVLVLFLLREFFFC-VGGRVWFIKDNDNN 69 >ref|XP_012569380.1| PREDICTED: ABC transporter C family member 5-like [Cicer arietinum] Length = 1532 Score = 61.2 bits (147), Expect = 1e-07 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -1 Query: 154 NTLLNAILELPILELVAICVNLTILILFLGRKVFVCVVGERVRFYKDN 11 +TL + IL LP+LELVAIC NL IL+LFL R+VF+C VG R FYKDN Sbjct: 18 DTLFSEILGLPLLELVAICTNLAILVLFLLREVFLC-VGGRFWFYKDN 64