BLASTX nr result
ID: Astragalus22_contig00030736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00030736 (751 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlise... 49 2e-06 >gb|EPS74167.1| hypothetical protein M569_00588, partial [Genlisea aurea] Length = 72 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +1 Query: 97 IELI*NFIGYKRVAGIEPASLAWKAKGYSRRSF 195 I L+ N + KRVAGIEPASLAWKAKGYSRR F Sbjct: 3 IRLVLNNVN-KRVAGIEPASLAWKAKGYSRRRF 34 Score = 32.3 bits (72), Expect(2) = 2e-06 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +2 Query: 206 LNVSNSKLNVKLLFHSAPL 262 L+VSNSK N+KL FHSAPL Sbjct: 37 LSVSNSKPNMKLWFHSAPL 55