BLASTX nr result
ID: Astragalus22_contig00030289
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00030289 (1504 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU30985.1| hypothetical protein TSUD_104990 [Trifolium subt... 67 4e-09 >dbj|GAU30985.1| hypothetical protein TSUD_104990 [Trifolium subterraneum] Length = 176 Score = 66.6 bits (161), Expect = 4e-09 Identities = 33/63 (52%), Positives = 43/63 (68%) Frame = -2 Query: 396 FCYGYGHPRKEAIKSNCSFYNENWKFCCKVKMLIPSMINDDIVDHLDNVADRGTEIFESY 217 F +G G+ RK A KSNCSF NEN F C V++ IPS+I+D I L +V D G ++FE Y Sbjct: 42 FLHGDGNARKVATKSNCSFTNENSYFLCMVQLHIPSVIHDGIAASLKDVIDSGYDLFEPY 101 Query: 216 VDS 208 V+S Sbjct: 102 VNS 104