BLASTX nr result
ID: Astragalus22_contig00030128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00030128 (318 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630936.1| PPR containing plant-like protein [Medicago ... 66 3e-10 gb|PNY11660.1| pentatricopeptide repeat-containing protein at4g2... 62 5e-09 ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containi... 62 7e-09 gb|KHN41349.1| Pentatricopeptide repeat-containing protein [Glyc... 59 8e-08 ref|XP_006587119.1| PREDICTED: pentatricopeptide repeat-containi... 59 8e-08 gb|KYP39482.1| Pentatricopeptide repeat-containing protein At4g2... 59 1e-07 gb|KHN05282.1| Pentatricopeptide repeat-containing protein [Glyc... 59 1e-07 gb|KRH12777.1| hypothetical protein GLYMA_15G193700 [Glycine max] 59 1e-07 ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-07 ref|XP_007138522.1| hypothetical protein PHAVU_009G216300g [Phas... 59 1e-07 ref|XP_020203036.1| pentatricopeptide repeat-containing protein ... 59 1e-07 ref|XP_014501087.1| pentatricopeptide repeat-containing protein ... 56 7e-07 ref|XP_019415839.1| PREDICTED: pentatricopeptide repeat-containi... 55 1e-06 gb|OIV98311.1| hypothetical protein TanjilG_16638 [Lupinus angus... 55 1e-06 ref|XP_017410279.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-06 dbj|BAT79937.1| hypothetical protein VIGAN_02288100 [Vigna angul... 55 2e-06 >ref|XP_003630936.1| PPR containing plant-like protein [Medicago truncatula] gb|AET05412.1| PPR containing plant-like protein [Medicago truncatula] Length = 959 Score = 65.9 bits (159), Expect = 3e-10 Identities = 33/77 (42%), Positives = 49/77 (63%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E V LF AM +GVK D I++ F P VL+ G KYC++ ++YI + Sbjct: 351 IAGYVQNGFTDEAVALFKAMVTSGVKLDS---ITFASFLPSVLKSGSLKYCKEVHSYIVR 407 Query: 52 HGLTFDIYVRSILIDKY 2 HG+ FD+Y++S L+D Y Sbjct: 408 HGVPFDVYLKSALVDIY 424 >gb|PNY11660.1| pentatricopeptide repeat-containing protein at4g21300-like protein [Trifolium pratense] Length = 768 Score = 62.4 bits (150), Expect = 5e-09 Identities = 31/77 (40%), Positives = 48/77 (62%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E V LF AM +GVK D I++ F P +LE G K+C++ ++YI + Sbjct: 235 IAGYVQNGFTDEAVALFKAMIASGVKLDS---ITFASFLPSILESGTLKHCKEVHSYIVR 291 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S L+D Y Sbjct: 292 HDVPFDVYLKSALVDIY 308 >ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Cicer arietinum] ref|XP_012572043.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Cicer arietinum] Length = 875 Score = 62.0 bits (149), Expect = 7e-09 Identities = 31/77 (40%), Positives = 47/77 (61%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E V LF AM +GVK D I++ F P +LE G C++ ++YI + Sbjct: 348 IAGYVQNGFTDEAVTLFKAMIASGVKPDS---ITFASFLPSILESGSLNNCKEVHSYIVR 404 Query: 52 HGLTFDIYVRSILIDKY 2 HG+ FD+Y++S L+D Y Sbjct: 405 HGVPFDVYLKSALVDIY 421 >gb|KHN41349.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 788 Score = 58.9 bits (141), Expect = 8e-08 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +LE G ++C++ ++YI + Sbjct: 261 IAGYVQNGFTDEAAPLFNAMISAGVKPDS---VTFASFLPSILESGSLRHCKEVHSYIVR 317 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 318 HRVPFDVYLKSALIDVY 334 >ref|XP_006587119.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617512.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617513.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617514.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617515.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] ref|XP_014617516.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] gb|KRH37767.1| hypothetical protein GLYMA_09G088000 [Glycine max] gb|KRH37768.1| hypothetical protein GLYMA_09G088000 [Glycine max] Length = 848 Score = 58.9 bits (141), Expect = 8e-08 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +LE G ++C++ ++YI + Sbjct: 321 IAGYVQNGFTDEAAPLFNAMISAGVKPDS---VTFASFLPSILESGSLRHCKEVHSYIVR 377 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 378 HRVPFDVYLKSALIDVY 394 >gb|KYP39482.1| Pentatricopeptide repeat-containing protein At4g21300 family [Cajanus cajan] Length = 724 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +L+ G K+C++ ++YI + Sbjct: 238 IAGYVQNGFTDEAAPLFNAMISVGVKPDS---VTFASFLPSILKSGSLKHCKEVHSYIVR 294 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 295 HRIPFDVYLKSALIDIY 311 >gb|KHN05282.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 772 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +LE G ++C++ ++YI + Sbjct: 245 IAGYVQNGFTDEAAPLFNAMISAGVKPDS---VTFASFLPSILESGSLRHCKEVHSYIVR 301 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 302 HRVPFDVYLKSALIDIY 318 >gb|KRH12777.1| hypothetical protein GLYMA_15G193700 [Glycine max] Length = 825 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +LE G ++C++ ++YI + Sbjct: 298 IAGYVQNGFTDEAAPLFNAMISAGVKPDS---VTFASFLPSILESGSLRHCKEVHSYIVR 354 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 355 HRVPFDVYLKSALIDIY 371 >ref|XP_003547574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Glycine max] Length = 846 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +LE G ++C++ ++YI + Sbjct: 319 IAGYVQNGFTDEAAPLFNAMISAGVKPDS---VTFASFLPSILESGSLRHCKEVHSYIVR 375 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 376 HRVPFDVYLKSALIDIY 392 >ref|XP_007138522.1| hypothetical protein PHAVU_009G216300g [Phaseolus vulgaris] gb|ESW10516.1| hypothetical protein PHAVU_009G216300g [Phaseolus vulgaris] Length = 848 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +L+ G K+C++ ++YI + Sbjct: 322 IAGYVQNGFTDEAAPLFNAMISAGVKPD---AVTFASFLPSILKSGSLKHCKEVHSYIVR 378 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 379 HRVPFDVYLKSALIDIY 395 >ref|XP_020203036.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203037.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203038.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203039.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] ref|XP_020203041.1| pentatricopeptide repeat-containing protein At4g21300 [Cajanus cajan] Length = 849 Score = 58.5 bits (140), Expect = 1e-07 Identities = 29/77 (37%), Positives = 46/77 (59%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E LF AM GVK D +++ F P +L+ G K+C++ ++YI + Sbjct: 322 IAGYVQNGFTDEAAPLFNAMISVGVKPDS---VTFASFLPSILKSGSLKHCKEVHSYIVR 378 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 379 HRIPFDVYLKSALIDIY 395 >ref|XP_014501087.1| pentatricopeptide repeat-containing protein At4g21300 [Vigna radiata var. radiata] Length = 848 Score = 56.2 bits (134), Expect = 7e-07 Identities = 29/77 (37%), Positives = 45/77 (58%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q ++E LF AM GVK D +++ F P VL+ G K+C++ + YI + Sbjct: 321 MAGYVQNGFSDEAAPLFNAMISAGVKPD---AVTFASFLPSVLKTGSLKHCKEVHGYIVR 377 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 378 HRVPFDVYLKSALIDIY 394 >ref|XP_019415839.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Lupinus angustifolius] ref|XP_019415840.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Lupinus angustifolius] ref|XP_019415841.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Lupinus angustifolius] Length = 857 Score = 55.5 bits (132), Expect = 1e-06 Identities = 31/77 (40%), Positives = 45/77 (58%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E V LF M TGVK D I++ F P ++E G K ++ ++YI + Sbjct: 325 IAGYVQNGFTDEAVPLFKEMISTGVKPDS---ITFASFLPSIVESGSIKRGKEIHSYIVR 381 Query: 52 HGLTFDIYVRSILIDKY 2 H L FD+Y++S LID Y Sbjct: 382 HRLPFDVYLKSALIDIY 398 >gb|OIV98311.1| hypothetical protein TanjilG_16638 [Lupinus angustifolius] Length = 929 Score = 55.5 bits (132), Expect = 1e-06 Identities = 31/77 (40%), Positives = 45/77 (58%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q T+E V LF M TGVK D I++ F P ++E G K ++ ++YI + Sbjct: 325 IAGYVQNGFTDEAVPLFKEMISTGVKPDS---ITFASFLPSIVESGSIKRGKEIHSYIVR 381 Query: 52 HGLTFDIYVRSILIDKY 2 H L FD+Y++S LID Y Sbjct: 382 HRLPFDVYLKSALIDIY 398 >ref|XP_017410279.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Vigna angularis] gb|KOM29530.1| hypothetical protein LR48_Vigan721s001200 [Vigna angularis] Length = 848 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/77 (36%), Positives = 45/77 (58%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q ++E LF AM GVK D +++ F P +L+ G K+C++ + YI + Sbjct: 321 MAGYVQNGFSDEAAPLFNAMISAGVKPD---AVTFASFLPSLLKSGSLKHCKEVHGYIVR 377 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 378 HRVPFDVYLKSALIDIY 394 >dbj|BAT79937.1| hypothetical protein VIGAN_02288100 [Vigna angularis var. angularis] Length = 863 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/77 (36%), Positives = 45/77 (58%) Frame = -3 Query: 232 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFYPPVLEYGCPKYCRKNYNYIGK 53 + Y Q ++E LF AM GVK D +++ F P +L+ G K+C++ + YI + Sbjct: 321 MAGYVQNGFSDEAAPLFNAMISAGVKPD---AVTFASFLPSLLKSGSLKHCKEVHGYIVR 377 Query: 52 HGLTFDIYVRSILIDKY 2 H + FD+Y++S LID Y Sbjct: 378 HRVPFDVYLKSALIDIY 394