BLASTX nr result
ID: Astragalus22_contig00030112
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00030112 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN17724.1| Pentatricopeptide repeat-containing protein [Glyc... 76 3e-13 ref|XP_014625434.1| PREDICTED: pentatricopeptide repeat-containi... 76 3e-13 ref|XP_020227312.1| pentatricopeptide repeat-containing protein ... 62 3e-08 ref|XP_022643228.1| pentatricopeptide repeat-containing protein ... 60 4e-08 ref|XP_014521342.1| pentatricopeptide repeat-containing protein ... 60 6e-08 ref|XP_017425948.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-07 ref|XP_004513678.1| PREDICTED: pentatricopeptide repeat-containi... 57 7e-07 ref|XP_024169036.1| pentatricopeptide repeat-containing protein ... 54 9e-06 >gb|KHN17724.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 544 Score = 75.9 bits (185), Expect = 3e-13 Identities = 47/88 (53%), Positives = 56/88 (63%), Gaps = 1/88 (1%) Frame = -3 Query: 267 PHGVAKHITSLSSFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSN 91 P+GV K +T SFFT IR SHYRTL + +K LI TP WFVKI+STLFL SN Sbjct: 5 PYGVEKLMTF--SFFTAIRASHYRTLTQATASDKGLIITTPDSWFVKIVSTLFL---CSN 59 Query: 90 SLSDPPFLSYLTNNLTPPLVFDIVKKLN 7 SL D FL Y +LTP V ++VK+ N Sbjct: 60 SLDD-RFLGYFREHLTPSHVLEVVKRFN 86 >ref|XP_014625434.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Glycine max] gb|KRH02605.1| hypothetical protein GLYMA_17G049100 [Glycine max] Length = 544 Score = 75.9 bits (185), Expect = 3e-13 Identities = 47/88 (53%), Positives = 56/88 (63%), Gaps = 1/88 (1%) Frame = -3 Query: 267 PHGVAKHITSLSSFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSN 91 P+GV K +T SFFT IR SHYRTL + +K LI TP WFVKI+STLFL SN Sbjct: 5 PYGVEKLMTF--SFFTAIRASHYRTLTQATASDKGLIITTPDSWFVKIVSTLFL---CSN 59 Query: 90 SLSDPPFLSYLTNNLTPPLVFDIVKKLN 7 SL D FL Y +LTP V ++VK+ N Sbjct: 60 SLDD-RFLGYFREHLTPSHVLEVVKRFN 86 >ref|XP_020227312.1| pentatricopeptide repeat-containing protein At2g06000 [Cajanus cajan] ref|XP_020227313.1| pentatricopeptide repeat-containing protein At2g06000 [Cajanus cajan] Length = 535 Score = 61.6 bits (148), Expect = 3e-08 Identities = 38/78 (48%), Positives = 50/78 (64%), Gaps = 3/78 (3%) Frame = -3 Query: 231 SFFTTIRLSHYRTLPPP-SHNKPLITLTPQH--WFVKIISTLFLLRTSSNSLSDPPFLSY 61 S FT R SHYRTL + +K L+T TP WFVKI+STLFL S+SL D F++Y Sbjct: 4 SSFTAFRASHYRTLTQVRASDKGLVTTTPNSDSWFVKIVSTLFL---RSDSLDD-SFVAY 59 Query: 60 LTNNLTPPLVFDIVKKLN 7 +LTP V ++V++LN Sbjct: 60 FRQHLTPSHVLEVVRRLN 77 >ref|XP_022643228.1| pentatricopeptide repeat-containing protein At2g06000 isoform X3 [Vigna radiata var. radiata] Length = 287 Score = 60.5 bits (145), Expect = 4e-08 Identities = 36/76 (47%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = -3 Query: 231 SFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSNSLSDPPFLSYLT 55 S T R SHYRTL K LI T WFVKI+STLFL TS D L Y Sbjct: 4 SLVTAFRASHYRTLTQVGLSEKRLIVTTTDSWFVKIVSTLFLCSTS----FDDEILDYFH 59 Query: 54 NNLTPPLVFDIVKKLN 7 +LTP V +I+K+LN Sbjct: 60 KHLTPSYVLEIIKRLN 75 >ref|XP_014521342.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_014521343.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_014521344.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_014521345.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_014521346.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_014521348.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_022643221.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_022643222.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_022643223.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_022643224.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] ref|XP_022643225.1| pentatricopeptide repeat-containing protein At2g06000 isoform X1 [Vigna radiata var. radiata] Length = 532 Score = 60.5 bits (145), Expect = 6e-08 Identities = 36/76 (47%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = -3 Query: 231 SFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSNSLSDPPFLSYLT 55 S T R SHYRTL K LI T WFVKI+STLFL TS D L Y Sbjct: 4 SLVTAFRASHYRTLTQVGLSEKRLIVTTTDSWFVKIVSTLFLCSTS----FDDEILDYFH 59 Query: 54 NNLTPPLVFDIVKKLN 7 +LTP V +I+K+LN Sbjct: 60 KHLTPSYVLEIIKRLN 75 >ref|XP_017425948.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] ref|XP_017425949.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] ref|XP_017425950.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like [Vigna angularis] gb|KOM45101.1| hypothetical protein LR48_Vigan06g040700 [Vigna angularis] dbj|BAU00134.1| hypothetical protein VIGAN_10170100 [Vigna angularis var. angularis] Length = 532 Score = 59.3 bits (142), Expect = 2e-07 Identities = 36/76 (47%), Positives = 41/76 (53%), Gaps = 1/76 (1%) Frame = -3 Query: 231 SFFTTIRLSHYRTLPPPS-HNKPLITLTPQHWFVKIISTLFLLRTSSNSLSDPPFLSYLT 55 S T R SHYRTL K LI T WFVKI+STLFL TS D L Y Sbjct: 4 SLVTAFRASHYRTLTQVRLSEKGLIITTTDSWFVKIVSTLFLCSTS----FDDKLLDYFR 59 Query: 54 NNLTPPLVFDIVKKLN 7 +LTP V +I+K+LN Sbjct: 60 KHLTPSHVLEIIKRLN 75 >ref|XP_004513678.1| PREDICTED: pentatricopeptide repeat-containing protein At2g06000-like, partial [Cicer arietinum] Length = 355 Score = 57.4 bits (137), Expect = 7e-07 Identities = 38/81 (46%), Positives = 47/81 (58%), Gaps = 6/81 (7%) Frame = -3 Query: 231 SFFTTIRLS------HYRTLPPPSHNKPLITLTPQHWFVKIISTLFLLRTSSNSLSDPPF 70 S FT +R+S HY TL P NKP WFVKI+ST+FLL S NS + F Sbjct: 5 SLFTPLRISKTTLITHYTTLTP---NKP------NPWFVKIVSTVFLL--SPNSFNHT-F 52 Query: 69 LSYLTNNLTPPLVFDIVKKLN 7 YL N+LTP L D++K+LN Sbjct: 53 SHYLANHLTPSLALDVIKRLN 73 >ref|XP_024169036.1| pentatricopeptide repeat-containing protein At2g06000 [Rosa chinensis] gb|PRQ20413.1| putative tetratricopeptide-like helical domain-containing protein [Rosa chinensis] Length = 581 Score = 54.3 bits (129), Expect = 9e-06 Identities = 30/74 (40%), Positives = 43/74 (58%), Gaps = 4/74 (5%) Frame = -3 Query: 216 IRLSHYRTL----PPPSHNKPLITLTPQHWFVKIISTLFLLRTSSNSLSDPPFLSYLTNN 49 I SH+ TL P P + L P+ WFVK++ TLFL S +S +L YL+ N Sbjct: 55 IAASHFHTLAGARPRPERE---VLLNPEAWFVKVVYTLFLRSHSLDS-----YLGYLSKN 106 Query: 48 LTPPLVFDIVKKLN 7 LTP L F+++++LN Sbjct: 107 LTPSLAFEVIRRLN 120