BLASTX nr result
ID: Astragalus22_contig00029861
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029861 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013451291.1| zinc-finger of monoamine-oxidase A repressor... 65 6e-10 >ref|XP_013451291.1| zinc-finger of monoamine-oxidase A repressor R1 [Medicago truncatula] gb|KEH25331.1| zinc-finger of monoamine-oxidase A repressor R1 [Medicago truncatula] Length = 634 Score = 65.5 bits (158), Expect = 6e-10 Identities = 44/115 (38%), Positives = 59/115 (51%), Gaps = 13/115 (11%) Frame = -1 Query: 352 DDARQNKRSKKAKLSNGVSGG----------ETKVDKNHDIVHGQMDGPEAWAANDFFFD 203 D+AR+NK+ K+ KLSNGVS G ETKV+++H ++H QMD P+A +AND F Sbjct: 218 DNARENKKLKRPKLSNGVSDGDVKRNADAEMETKVEQSHGMIHCQMDAPKACSANDDSFI 277 Query: 202 PKTLVSNGFPITSNPCSVKEMNLNNLNDAVAIGDGDSAGVVSQT---GLEAESLK 47 P M+ V I DG++AG SQT L AE +K Sbjct: 278 PNL-----------------MHGRICQGTVVIADGENAGAKSQTNAIALNAEKIK 315