BLASTX nr result
ID: Astragalus22_contig00029856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029856 (550 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630255.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase fami... 57 2e-06 >ref|XP_003630255.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago truncatula] gb|AET04731.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago truncatula] Length = 434 Score = 57.4 bits (137), Expect = 2e-06 Identities = 36/65 (55%), Positives = 40/65 (61%), Gaps = 10/65 (15%) Frame = -3 Query: 167 MTMSALNRSISFNRRT----LG------NRFGCVSLRFQVXXXXXXXXXXXXXIGGGYIY 18 M+ S LN+SISFNRR+ LG NRFGCVSLRFQV IGGGYIY Sbjct: 1 MSGSHLNKSISFNRRSHSQPLGSPKPIINRFGCVSLRFQVLVIIASVFSFFIAIGGGYIY 60 Query: 17 VLPSL 3 VLPS+ Sbjct: 61 VLPSI 65