BLASTX nr result
ID: Astragalus22_contig00029848
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029848 (310 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023929278.1| phosphoserine aminotransferase 2, chloroplas... 52 8e-06 >ref|XP_023929278.1| phosphoserine aminotransferase 2, chloroplastic-like [Quercus suber] Length = 180 Score = 52.0 bits (123), Expect = 8e-06 Identities = 30/58 (51%), Positives = 37/58 (63%), Gaps = 11/58 (18%) Frame = -2 Query: 294 QFGLIYTGAKK---------MWVDLYLL*I--FYMCGLMFEDLLERGGLVEVEKKNMK 154 +FG IY GA+K + + YL+ YMCGL FEDLL++GGLVEVEKKN K Sbjct: 31 KFGFIYAGAQKNVGPSGVTIVIIKKYLIGNDGIYMCGLAFEDLLDQGGLVEVEKKNKK 88