BLASTX nr result
ID: Astragalus22_contig00029756
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029756 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX99024.1| F-box protein [Trifolium pratense] 71 7e-12 dbj|GAU12653.1| hypothetical protein TSUD_121450 [Trifolium subt... 71 7e-12 gb|PNX86674.1| F-box protein [Trifolium pratense] 68 8e-11 gb|PNX90413.1| F-box protein [Trifolium pratense] 68 1e-10 ref|XP_003599197.1| F-box SKIP23-like protein [Medicago truncatu... 67 2e-10 ref|XP_019441118.1| PREDICTED: F-box protein SKIP23 [Lupinus ang... 67 3e-10 ref|XP_007148883.1| hypothetical protein PHAVU_005G022400g [Phas... 66 6e-10 ref|XP_014498520.1| F-box protein SKIP23 [Vigna radiata var. rad... 65 7e-10 ref|XP_017423155.1| PREDICTED: F-box protein SKIP23-like [Vigna ... 65 8e-10 ref|XP_004499887.1| PREDICTED: F-box protein SKIP23 [Cicer ariet... 65 1e-09 gb|PNX84456.1| F-box protein, partial [Trifolium pratense] 64 2e-09 gb|PNX82860.1| F-box protein, partial [Trifolium pratense] 64 2e-09 ref|XP_003599161.1| F-box SKIP23-like protein [Medicago truncatu... 64 2e-09 ref|XP_004499895.1| PREDICTED: F-box protein SKIP23-like [Cicer ... 64 2e-09 ref|XP_015893221.1| PREDICTED: F-box protein SKIP23 [Ziziphus ju... 64 2e-09 dbj|GAU12648.1| hypothetical protein TSUD_121400 [Trifolium subt... 64 3e-09 ref|XP_003599236.2| F-box SKIP28-like protein [Medicago truncatu... 64 4e-09 gb|PNY04261.1| F-box family protein [Trifolium pratense] 64 4e-09 ref|XP_003621011.1| F-box SKIP23-like protein [Medicago truncatu... 63 5e-09 ref|XP_003599172.1| F-box SKIP23-like protein [Medicago truncatu... 63 7e-09 >gb|PNX99024.1| F-box protein [Trifolium pratense] Length = 370 Score = 71.2 bits (173), Expect = 7e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 MADWSQLPTELLQLIS +LNS YLLRFRSVCS WRSS Sbjct: 1 MADWSQLPTELLQLISQKLNSDFYLLRFRSVCSAWRSS 38 >dbj|GAU12653.1| hypothetical protein TSUD_121450 [Trifolium subterraneum] Length = 388 Score = 71.2 bits (173), Expect = 7e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 MADWS LPTELLQLIS +LNS+ YLLRFRSVCSTWRSS Sbjct: 1 MADWSLLPTELLQLISQKLNSEFYLLRFRSVCSTWRSS 38 >gb|PNX86674.1| F-box protein [Trifolium pratense] Length = 360 Score = 68.2 bits (165), Expect = 8e-11 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 MADWS LPTELLQLIS +L S YLLRFRSVCSTWRSS Sbjct: 1 MADWSLLPTELLQLISQKLKSDFYLLRFRSVCSTWRSS 38 >gb|PNX90413.1| F-box protein [Trifolium pratense] Length = 369 Score = 67.8 bits (164), Expect = 1e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -2 Query: 219 DWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 DWS LPTELLQLIS +LNS+ YLLRFRSVCSTWRSS Sbjct: 5 DWSLLPTELLQLISEKLNSEFYLLRFRSVCSTWRSS 40 >ref|XP_003599197.1| F-box SKIP23-like protein [Medicago truncatula] gb|AES69448.1| F-box SKIP23-like protein [Medicago truncatula] Length = 423 Score = 67.4 bits (163), Expect = 2e-10 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = -2 Query: 243 PIIHPSMADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 P SMADWSQLP +LLQLIS++L+S+ Y LRFRSVCS+WRSS Sbjct: 8 PSASSSMADWSQLPKDLLQLISSKLDSEFYQLRFRSVCSSWRSS 51 >ref|XP_019441118.1| PREDICTED: F-box protein SKIP23 [Lupinus angustifolius] ref|XP_019441119.1| PREDICTED: F-box protein SKIP23 [Lupinus angustifolius] ref|XP_019441120.1| PREDICTED: F-box protein SKIP23 [Lupinus angustifolius] ref|XP_019441121.1| PREDICTED: F-box protein SKIP23 [Lupinus angustifolius] gb|OIW13107.1| hypothetical protein TanjilG_08140 [Lupinus angustifolius] Length = 395 Score = 66.6 bits (161), Expect = 3e-10 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 M +WSQLP ELL LIS RL S LYLLRFRSVCS+WRSST Sbjct: 1 MGEWSQLPKELLNLISQRLESSLYLLRFRSVCSSWRSST 39 >ref|XP_007148883.1| hypothetical protein PHAVU_005G022400g [Phaseolus vulgaris] gb|ESW20877.1| hypothetical protein PHAVU_005G022400g [Phaseolus vulgaris] Length = 374 Score = 65.9 bits (159), Expect = 6e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = -2 Query: 228 SMADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 SMADWS+LP +LL LIS RL + LYLLRFRSVCS+WRSS+ Sbjct: 14 SMADWSELPKDLLNLISQRLQNPLYLLRFRSVCSSWRSSS 53 >ref|XP_014498520.1| F-box protein SKIP23 [Vigna radiata var. radiata] ref|XP_022636937.1| F-box protein SKIP23 [Vigna radiata var. radiata] ref|XP_022636938.1| F-box protein SKIP23 [Vigna radiata var. radiata] ref|XP_022636939.1| F-box protein SKIP23 [Vigna radiata var. radiata] Length = 355 Score = 65.5 bits (158), Expect = 7e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 MADWS+LP +LL LIS RL S LYLLRFRSVCS+WRSS+ Sbjct: 1 MADWSELPKDLLNLISQRLQSPLYLLRFRSVCSSWRSSS 39 >ref|XP_017423155.1| PREDICTED: F-box protein SKIP23-like [Vigna angularis] gb|KOM42465.1| hypothetical protein LR48_Vigan05g006900 [Vigna angularis] dbj|BAT93343.1| hypothetical protein VIGAN_07229000 [Vigna angularis var. angularis] Length = 357 Score = 65.5 bits (158), Expect = 8e-10 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 MADWS+LP +LL LIS RL S LYLLRFRSVCS+WRSS+ Sbjct: 1 MADWSELPKDLLNLISQRLQSPLYLLRFRSVCSSWRSSS 39 >ref|XP_004499887.1| PREDICTED: F-box protein SKIP23 [Cicer arietinum] ref|XP_004499888.1| PREDICTED: F-box protein SKIP23 [Cicer arietinum] Length = 397 Score = 65.1 bits (157), Expect = 1e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 MADWS+LP +LLQLIS L S+ YLLRFRSVCSTWRSS Sbjct: 1 MADWSELPRDLLQLISEFLQSEFYLLRFRSVCSTWRSS 38 >gb|PNX84456.1| F-box protein, partial [Trifolium pratense] Length = 295 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 MADWS+LP+EL+Q I +LNS+LYLLRFRSVCS+WR S+ Sbjct: 1 MADWSELPSELVQQICQKLNSELYLLRFRSVCSSWRRSS 39 >gb|PNX82860.1| F-box protein, partial [Trifolium pratense] Length = 326 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 MADWS+LP+EL+Q I +LNS+LYLLRFRSVCS+WR S+ Sbjct: 1 MADWSELPSELVQQICQKLNSELYLLRFRSVCSSWRRSS 39 >ref|XP_003599161.1| F-box SKIP23-like protein [Medicago truncatula] gb|AES69412.1| F-box SKIP23-like protein [Medicago truncatula] Length = 377 Score = 64.3 bits (155), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSST 109 MADWS LP+ELLQLIS +L++ L LLRFRSVCSTWRSS+ Sbjct: 1 MADWSHLPSELLQLISQKLDTVLCLLRFRSVCSTWRSSS 39 >ref|XP_004499895.1| PREDICTED: F-box protein SKIP23-like [Cicer arietinum] Length = 392 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 MADW++LP E+LQLIS L S+LY++RFRSVCSTWRSS Sbjct: 1 MADWAELPREILQLISEFLQSELYIIRFRSVCSTWRSS 38 >ref|XP_015893221.1| PREDICTED: F-box protein SKIP23 [Ziziphus jujuba] Length = 401 Score = 64.3 bits (155), Expect = 2e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = -2 Query: 225 MADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 MADWSQLP EL++ I+NRL+S +YLLRFRSVCS+WRS+ Sbjct: 1 MADWSQLPKELIEEIANRLHSPIYLLRFRSVCSSWRSA 38 >dbj|GAU12648.1| hypothetical protein TSUD_121400 [Trifolium subterraneum] Length = 425 Score = 63.9 bits (154), Expect = 3e-09 Identities = 30/42 (71%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -2 Query: 234 HPSMA-DWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 HP +A DWSQLP +LL+LIS +LNS+ Y LRFRSVCS+WRSS Sbjct: 34 HPFVAADWSQLPEDLLRLISEKLNSEFYQLRFRSVCSSWRSS 75 >ref|XP_003599236.2| F-box SKIP28-like protein [Medicago truncatula] gb|AES69487.2| F-box SKIP28-like protein [Medicago truncatula] Length = 381 Score = 63.5 bits (153), Expect = 4e-09 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -2 Query: 222 ADWSQLPTELLQLISNRL-NSQLYLLRFRSVCSTWRSS 112 ADWSQLP ELLQLIS +L NS+LYLLRFRSVCSTW SS Sbjct: 3 ADWSQLPRELLQLISQKLDNSELYLLRFRSVCSTWCSS 40 >gb|PNY04261.1| F-box family protein [Trifolium pratense] Length = 437 Score = 63.5 bits (153), Expect = 4e-09 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 297 FFHISQNQFSTPPIDYTPPIIHPSMA-DWSQLPTELLQLISNRLNSQLYLLRFRSVCSTW 121 +F IS+ + PP P MA DW+QLP +LLQ IS +LNS+ Y LRFRSVCS+W Sbjct: 21 YFPISRGKQPPPP---------PFMAADWTQLPKDLLQFISEKLNSEFYQLRFRSVCSSW 71 Query: 120 RSS 112 RSS Sbjct: 72 RSS 74 >ref|XP_003621011.1| F-box SKIP23-like protein [Medicago truncatula] gb|AES77229.1| F-box SKIP23-like protein [Medicago truncatula] Length = 361 Score = 63.2 bits (152), Expect = 5e-09 Identities = 30/38 (78%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -2 Query: 219 DWSQLPTELLQLISNRL-NSQLYLLRFRSVCSTWRSST 109 DWSQLP+ELLQLIS +L N +LYL+RFRSVCSTWRSS+ Sbjct: 4 DWSQLPSELLQLISQKLSNIELYLIRFRSVCSTWRSSS 41 >ref|XP_003599172.1| F-box SKIP23-like protein [Medicago truncatula] gb|AES69423.1| F-box SKIP23-like protein [Medicago truncatula] Length = 360 Score = 62.8 bits (151), Expect = 7e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 222 ADWSQLPTELLQLISNRLNSQLYLLRFRSVCSTWRSS 112 ADWSQLP ELLQLIS +LN +LYL+R RSVCS WRSS Sbjct: 3 ADWSQLPRELLQLISQKLNRELYLIRSRSVCSWWRSS 39