BLASTX nr result
ID: Astragalus22_contig00029747
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029747 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013443448.1| transmembrane protein, putative [Medicago tr... 107 1e-23 ref|XP_013442094.1| hypothetical protein MTR_0319s0020 [Medicago... 97 4e-21 >ref|XP_013443448.1| transmembrane protein, putative [Medicago truncatula] gb|KEH17473.1| transmembrane protein, putative [Medicago truncatula] Length = 633 Score = 107 bits (266), Expect = 1e-23 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 1/104 (0%) Frame = +3 Query: 3 AKVFKQKILDKIPTMIFPPYVPDKYFFVLTQNKIRFPPLPTSELALAFWSPIPEWFVCGS 182 AK + KI DKIP+M FPP+ P KY F L K++FP LPTS+L +AF SP P+W C S Sbjct: 437 AKTLRDKIYDKIPSMTFPPFTPSKYLFAL-HFKMKFPALPTSQLTVAFRSPYPKWLYCDS 495 Query: 183 TK-LRNFLLTKTAEKVVSTKHTLHTFEGHLHLDIRHVRVTSMIG 311 ++ + K +KV TKH L+TF GHLHLD+ ++R+ IG Sbjct: 496 LLGMKQKFIKKDKDKVTDTKHNLYTFRGHLHLDLPNIRILFEIG 539 >ref|XP_013442094.1| hypothetical protein MTR_0319s0020 [Medicago truncatula] gb|KEH16119.1| hypothetical protein MTR_0319s0020 [Medicago truncatula] Length = 295 Score = 97.1 bits (240), Expect = 4e-21 Identities = 57/163 (34%), Positives = 81/163 (49%), Gaps = 5/163 (3%) Frame = +3 Query: 45 MIFPPYVPDKYFFVLTQNKIRFPPLPTSELALAFWSPIPEWFVCGSTK-LRNFLLTKTAE 221 M FPP+ P KY F L K RFP LPTS LALAF P P+W C S ++ + + + Sbjct: 1 MSFPPFTPSKYLFAL-HFKTRFPVLPTSPLALAFRPPYPKWLFCDSLMGMKQKFIKREKD 59 Query: 222 KVVSTKHTLHTFEGHLHLDIRHVRVTSMIGEGDISNS*KNLISLLCMICAYMFCRISVAV 401 +V +TKH+L+TF HLHL+ H+R+ S IG +A+ Sbjct: 60 RVTATKHSLYTFRWHLHLNYPHIRILSEIG---------------------------LAL 92 Query: 402 PIVSDST----DDQTTKAKKKSIETSSKKDQTPQEEKPKNRKR 518 P+ S+ +D + K K + SSK D+ + EKP K+ Sbjct: 93 PLASEEVEYPEEDSSRKTSKSKSDKSSKTDKKKKSEKPSKGKQ 135