BLASTX nr result
ID: Astragalus22_contig00029509
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029509 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022879810.1| transmembrane protein 184 homolog DDB_G02795... 50 4e-06 ref|XP_018843888.1| PREDICTED: transmembrane protein 184B [Jugla... 54 5e-06 >ref|XP_022879810.1| transmembrane protein 184 homolog DDB_G0279555-like [Olea europaea var. sylvestris] Length = 74 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +2 Query: 47 IAMVILYIHRHLLNYTKPTY*RFIVRINFMVLV 145 IA+ IL+I+RHLLNYT+PTY R+IVRI FMV V Sbjct: 18 IALAILHIYRHLLNYTEPTYQRYIVRIIFMVPV 50 >ref|XP_018843888.1| PREDICTED: transmembrane protein 184B [Juglans regia] ref|XP_018843889.1| PREDICTED: transmembrane protein 184B [Juglans regia] Length = 421 Score = 53.5 bits (127), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 47 IAMVILYIHRHLLNYTKPTY*RFIVRINFMVLV 145 IA+ I++I+RHLLNYT+PTY RFIVRI FMVLV Sbjct: 21 IALAIMHIYRHLLNYTEPTYQRFIVRIIFMVLV 53