BLASTX nr result
ID: Astragalus22_contig00029449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029449 (316 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX93712.1| pentatricopeptide repeat-containing protein mitoc... 69 3e-11 ref|XP_003624580.1| PPR containing plant-like protein [Medicago ... 64 1e-09 ref|XP_003548477.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-08 ref|XP_020218600.1| pentatricopeptide repeat-containing protein ... 59 8e-08 ref|XP_020211163.1| pentatricopeptide repeat-containing protein ... 55 2e-06 ref|XP_004493133.1| PREDICTED: pentatricopeptide repeat-containi... 55 2e-06 ref|XP_014491196.1| pentatricopeptide repeat-containing protein ... 54 6e-06 >gb|PNX93712.1| pentatricopeptide repeat-containing protein mitochondrial-like [Trifolium pratense] Length = 606 Score = 68.6 bits (166), Expect = 3e-11 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNPLDYGT 315 MIRIRS LSVF+VVL+ +N FTVNHCDIVQ PLMS +FNVFN +Y T Sbjct: 1 MIRIRSKLSVFTVVLSHIRKNPFTVNHCDIVQNPLMS-VSFNVFNSSNYDT 50 >ref|XP_003624580.1| PPR containing plant-like protein [Medicago truncatula] gb|AES80798.1| PPR containing plant-like protein [Medicago truncatula] Length = 585 Score = 64.3 bits (155), Expect = 1e-09 Identities = 32/51 (62%), Positives = 38/51 (74%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNPLDYGT 315 MIRIRSNLSVFS+ L R N+ TVNHCDIV +PLM+ +FN FN +Y T Sbjct: 1 MIRIRSNLSVFSIALLRIRHNAITVNHCDIVHKPLMNA-SFNAFNSSNYYT 50 >ref|XP_003548477.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Glycine max] gb|KRH06751.1| hypothetical protein GLYMA_16G043600 [Glycine max] Length = 612 Score = 59.7 bits (143), Expect = 4e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNP 300 MIRIRSNL +FSVVL+R S NS VNHC IV++PLM FN F+P Sbjct: 1 MIRIRSNLPLFSVVLSRISHNSIAVNHCHIVKKPLMGA-TFNFFDP 45 >ref|XP_020218600.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Cajanus cajan] Length = 602 Score = 58.9 bits (141), Expect = 8e-08 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNP 300 MIRIRSNL VFSVVL+R NS NHC +V++P+MS FN +NP Sbjct: 1 MIRIRSNLPVFSVVLSRIGHNSLAFNHCHVVEEPVMSAI-FNFYNP 45 >ref|XP_020211163.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Cajanus cajan] ref|XP_020211165.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Cajanus cajan] Length = 600 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNP 300 MIRIR NL VFS VL+R NS NHC +V++P+MS FN FNP Sbjct: 1 MIRIRFNLPVFSGVLSRIGHNSLAFNHCHVVEEPVMSAI-FNFFNP 45 >ref|XP_004493133.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Cicer arietinum] Length = 602 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNPLDY 309 MIRIRSNLSV VL R +QN VNHCDIV +PLMS +FN FN +Y Sbjct: 1 MIRIRSNLSV---VLLRITQNPIAVNHCDIVHKPLMS-VSFNGFNSSNY 45 >ref|XP_014491196.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Vigna radiata var. radiata] ref|XP_014491197.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Vigna radiata var. radiata] ref|XP_014491198.1| pentatricopeptide repeat-containing protein At5g15010, mitochondrial [Vigna radiata var. radiata] Length = 611 Score = 53.5 bits (127), Expect = 6e-06 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = +1 Query: 163 MIRIRSNLSVFSVVLARFSQNSFTVNHCDIVQQPLMSRFAFNVFNPLDYGT 315 M RI S LS+ SVVL R + NS VN C +V+QPLMS AFN NP Y T Sbjct: 1 MNRIGSRLSLLSVVLLRVNHNSLIVNRCHVVEQPLMSD-AFNFINPFKYDT 50