BLASTX nr result
ID: Astragalus22_contig00029300
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029300 (331 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006599370.1| PREDICTED: auxilin-related protein 2-like [G... 74 1e-14 gb|KHN11110.1| Auxilin-related protein 1 [Glycine soja] 74 7e-13 gb|KHN36088.1| Auxilin-related protein 2 [Glycine soja] 74 7e-13 gb|OIV94807.1| hypothetical protein TanjilG_22004 [Lupinus angus... 74 7e-13 ref|XP_019421915.1| PREDICTED: auxilin-related protein 1-like [L... 74 7e-13 gb|KYP53181.1| UBA domain-containing protein 7 [Cajanus cajan] 74 7e-13 ref|XP_007156969.1| hypothetical protein PHAVU_002G032500g [Phas... 74 7e-13 gb|KYP66796.1| UBA domain-containing protein 7 [Cajanus cajan] 74 7e-13 ref|XP_020216556.1| auxilin-like protein 1 [Cajanus cajan] 74 7e-13 gb|KHN41951.1| Auxilin-related protein 2 [Glycine soja] 74 7e-13 ref|XP_003537600.2| PREDICTED: auxilin-like protein 1 isoform X1... 74 7e-13 gb|KRH76749.1| hypothetical protein GLYMA_01G172200 [Glycine max... 74 7e-13 ref|XP_014519207.1| auxilin-like protein 1 isoform X2 [Vigna rad... 74 7e-13 ref|XP_006573573.1| PREDICTED: auxilin-like protein 1 [Glycine m... 74 7e-13 ref|XP_014519206.1| auxilin-like protein 1 isoform X1 [Vigna rad... 74 7e-13 ref|XP_017427561.1| PREDICTED: auxilin-like protein 1 [Vigna ang... 74 7e-13 ref|XP_007156063.1| hypothetical protein PHAVU_003G255200g [Phas... 74 7e-13 ref|XP_007156064.1| hypothetical protein PHAVU_003G255200g [Phas... 74 7e-13 ref|XP_012573701.1| PREDICTED: auxilin-like protein 1 [Cicer ari... 74 7e-13 ref|XP_014510655.1| auxilin-like protein 1 [Vigna radiata var. r... 74 7e-13 >ref|XP_006599370.1| PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 114 Score = 73.6 bits (179), Expect = 1e-14 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 80 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 113 >gb|KHN11110.1| Auxilin-related protein 1 [Glycine soja] Length = 488 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 454 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 487 >gb|KHN36088.1| Auxilin-related protein 2 [Glycine soja] Length = 862 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 828 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 861 >gb|OIV94807.1| hypothetical protein TanjilG_22004 [Lupinus angustifolius] Length = 1295 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1261 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1294 >ref|XP_019421915.1| PREDICTED: auxilin-related protein 1-like [Lupinus angustifolius] Length = 1298 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1264 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1297 >gb|KYP53181.1| UBA domain-containing protein 7 [Cajanus cajan] Length = 1313 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1279 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1312 >ref|XP_007156969.1| hypothetical protein PHAVU_002G032500g [Phaseolus vulgaris] gb|ESW28963.1| hypothetical protein PHAVU_002G032500g [Phaseolus vulgaris] Length = 1329 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1295 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1328 >gb|KYP66796.1| UBA domain-containing protein 7 [Cajanus cajan] Length = 1349 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1315 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1348 >ref|XP_020216556.1| auxilin-like protein 1 [Cajanus cajan] Length = 1364 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1330 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1363 >gb|KHN41951.1| Auxilin-related protein 2 [Glycine soja] Length = 1388 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1354 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1387 >ref|XP_003537600.2| PREDICTED: auxilin-like protein 1 isoform X1 [Glycine max] gb|KRH28713.1| hypothetical protein GLYMA_11G071000 [Glycine max] Length = 1388 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1354 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1387 >gb|KRH76749.1| hypothetical protein GLYMA_01G172200 [Glycine max] gb|KRH76750.1| hypothetical protein GLYMA_01G172200 [Glycine max] Length = 1396 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1362 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1395 >ref|XP_014519207.1| auxilin-like protein 1 isoform X2 [Vigna radiata var. radiata] Length = 1399 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1365 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1398 >ref|XP_006573573.1| PREDICTED: auxilin-like protein 1 [Glycine max] ref|XP_014631330.1| PREDICTED: auxilin-like protein 1 [Glycine max] ref|XP_014631332.1| PREDICTED: auxilin-like protein 1 [Glycine max] gb|KRH76751.1| hypothetical protein GLYMA_01G172200 [Glycine max] gb|KRH76752.1| hypothetical protein GLYMA_01G172200 [Glycine max] gb|KRH76753.1| hypothetical protein GLYMA_01G172200 [Glycine max] gb|KRH76754.1| hypothetical protein GLYMA_01G172200 [Glycine max] Length = 1404 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1370 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1403 >ref|XP_014519206.1| auxilin-like protein 1 isoform X1 [Vigna radiata var. radiata] Length = 1407 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1373 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1406 >ref|XP_017427561.1| PREDICTED: auxilin-like protein 1 [Vigna angularis] gb|KOM45174.1| hypothetical protein LR48_Vigan06g048000 [Vigna angularis] dbj|BAU00047.1| hypothetical protein VIGAN_10160500 [Vigna angularis var. angularis] Length = 1409 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1375 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1408 >ref|XP_007156063.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] gb|ESW28057.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] Length = 1421 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1387 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1420 >ref|XP_007156064.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] gb|ESW28058.1| hypothetical protein PHAVU_003G255200g [Phaseolus vulgaris] Length = 1422 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1388 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1421 >ref|XP_012573701.1| PREDICTED: auxilin-like protein 1 [Cicer arietinum] Length = 1447 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1413 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1446 >ref|XP_014510655.1| auxilin-like protein 1 [Vigna radiata var. radiata] Length = 1485 Score = 73.6 bits (179), Expect = 7e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 331 DKLQQRGASIQHKYICEKVFDLLKDAWNKFNSEE 230 DKLQQRGASIQHKYICEKVFDLLK+AWNKFNSEE Sbjct: 1451 DKLQQRGASIQHKYICEKVFDLLKEAWNKFNSEE 1484