BLASTX nr result
ID: Astragalus22_contig00029017
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00029017 (335 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012574162.1| PREDICTED: pentatricopeptide repeat-containi... 54 4e-06 ref|XP_003604256.2| PPR containing plant-like protein [Medicago ... 54 8e-06 >ref|XP_012574162.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010 [Cicer arietinum] Length = 587 Score = 54.3 bits (129), Expect = 4e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 189 VNYVRHSLKWVLLDFIKRCNDFRSFKQIHA 278 +N HSLKWVLLDFI+RCND RSFKQIHA Sbjct: 1 MNKGTHSLKWVLLDFIQRCNDLRSFKQIHA 30 >ref|XP_003604256.2| PPR containing plant-like protein [Medicago truncatula] gb|AES86453.2| PPR containing plant-like protein [Medicago truncatula] Length = 595 Score = 53.5 bits (127), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 189 VNYVRHSLKWVLLDFIKRCNDFRSFKQIHA 278 +N HS+KWVLLDFI+RCND RSFKQIHA Sbjct: 1 MNKGTHSMKWVLLDFIQRCNDLRSFKQIHA 30