BLASTX nr result
ID: Astragalus22_contig00028986
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00028986 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012572527.1| PREDICTED: transport and Golgi organization ... 58 2e-07 dbj|GAU28937.1| hypothetical protein TSUD_59480 [Trifolium subte... 54 4e-06 >ref|XP_012572527.1| PREDICTED: transport and Golgi organization 2 homolog [Cicer arietinum] Length = 263 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 91 QAARLRHNFKELIDEYGEGEFSIKEMVEKL 2 +A RLRHNFKELIDEYGEGEF IKEMVEKL Sbjct: 155 KAERLRHNFKELIDEYGEGEFPIKEMVEKL 184 >dbj|GAU28937.1| hypothetical protein TSUD_59480 [Trifolium subterraneum] Length = 263 Score = 54.3 bits (129), Expect = 4e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 91 QAARLRHNFKELIDEYGEGEFSIKEMVEKL 2 +A RLRH+FKELIDE+GEGEF IKEMVEKL Sbjct: 155 KAERLRHSFKELIDEFGEGEFPIKEMVEKL 184