BLASTX nr result
ID: Astragalus22_contig00028793
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00028793 (320 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN37555.1| Guanylate kinase [Glycine soja] 53 1e-06 gb|KDP40086.1| hypothetical protein JCGZ_02084 [Jatropha curcas] 55 2e-06 gb|KHN33078.1| Guanylate kinase [Glycine soja] 52 2e-06 ref|XP_012069501.1| guanylate kinase 3, chloroplastic [Jatropha ... 55 2e-06 ref|XP_007147790.1| hypothetical protein PHAVU_006G155400g [Phas... 54 5e-06 >gb|KHN37555.1| Guanylate kinase [Glycine soja] Length = 109 Score = 52.8 bits (125), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 215 YFCVIAKGKLDNAVKLVESIIDAEKAKVRQRIPVI 111 Y V AKGKLDNAVKL+ESIIDAEKA+V QR P++ Sbjct: 75 YVVVNAKGKLDNAVKLMESIIDAEKARVSQRTPLL 109 >gb|KDP40086.1| hypothetical protein JCGZ_02084 [Jatropha curcas] Length = 239 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 215 YFCVIAKGKLDNAVKLVESIIDAEKAKVRQRIPVI 111 Y V A+GKLD+AVKLVESIIDAEKAKVRQR PV+ Sbjct: 205 YIVVNAEGKLDSAVKLVESIIDAEKAKVRQRKPVL 239 >gb|KHN33078.1| Guanylate kinase [Glycine soja] Length = 71 Score = 51.6 bits (122), Expect = 2e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 215 YFCVIAKGKLDNAVKLVESIIDAEKAKVRQRIP 117 Y V AKGKLDNAVKL+ESIIDAEKA+V QR P Sbjct: 37 YVVVNAKGKLDNAVKLMESIIDAEKARVSQRTP 69 >ref|XP_012069501.1| guanylate kinase 3, chloroplastic [Jatropha curcas] Length = 292 Score = 54.7 bits (130), Expect = 2e-06 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 215 YFCVIAKGKLDNAVKLVESIIDAEKAKVRQRIPVI 111 Y V A+GKLD+AVKLVESIIDAEKAKVRQR PV+ Sbjct: 258 YIVVNAEGKLDSAVKLVESIIDAEKAKVRQRKPVL 292 >ref|XP_007147790.1| hypothetical protein PHAVU_006G155400g [Phaseolus vulgaris] ref|XP_007147791.1| hypothetical protein PHAVU_006G155400g [Phaseolus vulgaris] gb|ESW19784.1| hypothetical protein PHAVU_006G155400g [Phaseolus vulgaris] gb|ESW19785.1| hypothetical protein PHAVU_006G155400g [Phaseolus vulgaris] Length = 298 Score = 53.5 bits (127), Expect = 5e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 215 YFCVIAKGKLDNAVKLVESIIDAEKAKVRQRIPVI 111 Y V AKGKLDNAVKL+ESIIDAEKA+V QR P+I Sbjct: 264 YVVVNAKGKLDNAVKLMESIIDAEKARVSQRTPLI 298