BLASTX nr result
ID: Astragalus22_contig00028691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00028691 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX70365.1| DNA repair and recombination RAD54-like protein, ... 67 4e-11 gb|PNX89922.1| kunitz type trypsin inhibitor [Trifolium pratense] 61 5e-09 gb|PNY01732.1| hypothetical protein L195_g025033 [Trifolium prat... 55 3e-07 >gb|PNX70365.1| DNA repair and recombination RAD54-like protein, partial [Trifolium pratense] Length = 188 Score = 67.0 bits (162), Expect = 4e-11 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 129 MRLRCGKTGD*RSQRNCGGMPLRRLPQPQYCGRNRCCGPQFET 1 MRLRCG+T + RS RNCG M LR LP QYCGRN CGPQF+T Sbjct: 1 MRLRCGRTRELRSHRNCGAMRLRWLPHQQYCGRNCGCGPQFKT 43 >gb|PNX89922.1| kunitz type trypsin inhibitor [Trifolium pratense] Length = 147 Score = 60.8 bits (146), Expect = 5e-09 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +2 Query: 2 VSNCGPQHLLRPQYCGCGSRRNGIPPQLRCDLQS 103 V NCGP HL++PQYCGCG +RN I PQLRC+L+S Sbjct: 51 VLNCGPHHLMQPQYCGCGRQRNRIRPQLRCELRS 84 >gb|PNY01732.1| hypothetical protein L195_g025033 [Trifolium pratense] Length = 99 Score = 55.1 bits (131), Expect = 3e-07 Identities = 29/57 (50%), Positives = 33/57 (57%), Gaps = 14/57 (24%) Frame = -3 Query: 129 MRLRCGKTGD*RSQRNCGGM--------------PLRRLPQPQYCGRNRCCGPQFET 1 MRL+C +T + RS RNCGG LRRLP QYCGRN CGPQF+T Sbjct: 14 MRLQCSRTRELRSHRNCGGYHLSNTAAAIADADRXLRRLPLWQYCGRNCGCGPQFKT 70