BLASTX nr result
ID: Astragalus22_contig00028658
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00028658 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU13045.1| hypothetical protein TSUD_173450 [Trifolium subt... 66 2e-09 dbj|GAU13047.1| hypothetical protein TSUD_173470 [Trifolium subt... 59 4e-07 >dbj|GAU13045.1| hypothetical protein TSUD_173450 [Trifolium subterraneum] Length = 343 Score = 65.9 bits (159), Expect = 2e-09 Identities = 36/86 (41%), Positives = 47/86 (54%), Gaps = 1/86 (1%) Frame = +1 Query: 274 LINLPFLKTLYMNGINLEEGGFRHFKNLIHECPLLEDFRAQDVIVDTNHICDDTSGIFNG 453 ++NLP LKTL+ IN E R K +H CP+LED QD++ +C+ G FNG Sbjct: 154 IVNLPLLKTLHFENINFSELDPRFLKTFLHGCPVLEDLDLQDIL-----LCNRKCGEFNG 208 Query: 454 FPNLVRAYFN-GRYQHFPFAWFVKAK 528 LV+A N + FPFAW AK Sbjct: 209 LLKLVKANINIKKGWIFPFAWIPNAK 234 >dbj|GAU13047.1| hypothetical protein TSUD_173470 [Trifolium subterraneum] Length = 387 Score = 59.3 bits (142), Expect = 4e-07 Identities = 34/85 (40%), Positives = 46/85 (54%), Gaps = 1/85 (1%) Frame = +1 Query: 277 INLPFLKTLYMNGINLE-EGGFRHFKNLIHECPLLEDFRAQDVIVDTNHICDDTSGIFNG 453 +N P LKTL+ I K ++H CP+LED + QD+++ +NH C G FNG Sbjct: 153 VNFPLLKTLHFENIRFSLVNPILFLKRILHGCPVLEDLQLQDMLL-SNHKC----GEFNG 207 Query: 454 FPNLVRAYFNGRYQHFPFAWFVKAK 528 LV+A N + FPFAW AK Sbjct: 208 LLKLVKANINIKGWVFPFAWVRNAK 232