BLASTX nr result
ID: Astragalus22_contig00027679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00027679 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003630936.1| PPR containing plant-like protein [Medicago ... 60 2e-08 gb|PNY11660.1| pentatricopeptide repeat-containing protein at4g2... 57 3e-07 ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containi... 57 5e-07 >ref|XP_003630936.1| PPR containing plant-like protein [Medicago truncatula] gb|AET05412.1| PPR containing plant-like protein [Medicago truncatula] Length = 959 Score = 60.5 bits (145), Expect = 2e-08 Identities = 31/73 (42%), Positives = 46/73 (63%) Frame = +3 Query: 87 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFSPPVLEYGCPKYCRKNYNYIGK 266 + Y Q T+E V LF AM +GVK D I++ F P VL+ G KYC++ ++YI + Sbjct: 351 IAGYVQNGFTDEAVALFKAMVTSGVKLDS---ITFASFLPSVLKSGSLKYCKEVHSYIVR 407 Query: 267 HGMTFDIYVRSIL 305 HG+ FD+Y++S L Sbjct: 408 HGVPFDVYLKSAL 420 >gb|PNY11660.1| pentatricopeptide repeat-containing protein at4g21300-like protein [Trifolium pratense] Length = 768 Score = 57.0 bits (136), Expect = 3e-07 Identities = 29/73 (39%), Positives = 45/73 (61%) Frame = +3 Query: 87 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFSPPVLEYGCPKYCRKNYNYIGK 266 + Y Q T+E V LF AM +GVK D I++ F P +LE G K+C++ ++YI + Sbjct: 235 IAGYVQNGFTDEAVALFKAMIASGVKLDS---ITFASFLPSILESGTLKHCKEVHSYIVR 291 Query: 267 HGMTFDIYVRSIL 305 H + FD+Y++S L Sbjct: 292 HDVPFDVYLKSAL 304 >ref|XP_004503357.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Cicer arietinum] ref|XP_012572043.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Cicer arietinum] Length = 875 Score = 56.6 bits (135), Expect = 5e-07 Identities = 29/73 (39%), Positives = 44/73 (60%) Frame = +3 Query: 87 VTSYPQVASTNEVVLLFIAMCFTGVKQDFQHLISYVCFSPPVLEYGCPKYCRKNYNYIGK 266 + Y Q T+E V LF AM +GVK D I++ F P +LE G C++ ++YI + Sbjct: 348 IAGYVQNGFTDEAVTLFKAMIASGVKPDS---ITFASFLPSILESGSLNNCKEVHSYIVR 404 Query: 267 HGMTFDIYVRSIL 305 HG+ FD+Y++S L Sbjct: 405 HGVPFDVYLKSAL 417