BLASTX nr result
ID: Astragalus22_contig00027473
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00027473 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014491926.1| interactor of constitutive active ROPs 2, ch... 137 7e-35 gb|KYP43922.1| hypothetical protein KK1_034604 [Cajanus cajan] 137 7e-35 ref|XP_020238115.1| interactor of constitutive active ROPs 2, ch... 137 8e-35 ref|XP_016184886.1| interactor of constitutive active ROPs 2, ch... 137 9e-35 ref|XP_015937995.1| interactor of constitutive active ROPs 2, ch... 137 9e-35 ref|XP_016184883.1| interactor of constitutive active ROPs 2, ch... 137 9e-35 ref|XP_015937991.1| interactor of constitutive active ROPs 2, ch... 137 9e-35 ref|XP_007144532.1| hypothetical protein PHAVU_007G163800g [Phas... 136 1e-34 dbj|GAU26745.1| hypothetical protein TSUD_317430 [Trifolium subt... 136 1e-34 ref|XP_006594118.1| PREDICTED: interactor of constitutive active... 136 2e-34 ref|XP_003542499.1| PREDICTED: interactor of constitutive active... 136 2e-34 gb|KHN48324.1| Interactor of constitutive active ROPs 2, chlorop... 136 2e-34 ref|XP_017405929.1| PREDICTED: interactor of constitutive active... 135 2e-34 ref|XP_019428539.1| PREDICTED: interactor of constitutive active... 133 2e-33 ref|XP_019428537.1| PREDICTED: interactor of constitutive active... 133 2e-33 gb|PNY06087.1| interactor of constitutive active ROPs-like prote... 132 4e-33 ref|XP_019433286.1| PREDICTED: interactor of constitutive active... 130 5e-33 ref|XP_006588764.1| PREDICTED: interactor of constitutive active... 132 6e-33 gb|KHN39107.1| Interactor of constitutive active ROPs 2, chlorop... 132 6e-33 ref|XP_006588759.1| PREDICTED: interactor of constitutive active... 132 6e-33 >ref|XP_014491926.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_014491927.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_014491928.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_022633668.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] ref|XP_022633669.1| interactor of constitutive active ROPs 2, chloroplastic [Vigna radiata var. radiata] Length = 622 Score = 137 bits (345), Expect = 7e-35 Identities = 65/81 (80%), Positives = 70/81 (86%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YN+I+ K+SSPYSEDTDDD Sbjct: 542 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNTISAKMSSPYSEDTDDD 601 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 602 SPKKKNTNMLKKIGVLWKKNH 622 >gb|KYP43922.1| hypothetical protein KK1_034604 [Cajanus cajan] Length = 579 Score = 137 bits (344), Expect = 7e-35 Identities = 65/81 (80%), Positives = 69/81 (85%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLD+ YNSI K+SSPYSEDTDDD Sbjct: 499 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDNSYNSITAKMSSPYSEDTDDD 558 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 559 SPKKKNTNMLKKIGVLWKKNH 579 >ref|XP_020238115.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238116.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238117.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238118.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238119.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] ref|XP_020238121.1| interactor of constitutive active ROPs 2, chloroplastic-like [Cajanus cajan] Length = 600 Score = 137 bits (344), Expect = 8e-35 Identities = 65/81 (80%), Positives = 69/81 (85%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLD+ YNSI K+SSPYSEDTDDD Sbjct: 520 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDNSYNSITAKMSSPYSEDTDDD 579 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 580 SPKKKNTNMLKKIGVLWKKNH 600 >ref|XP_016184886.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis ipaensis] ref|XP_020972438.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis ipaensis] Length = 611 Score = 137 bits (344), Expect = 9e-35 Identities = 64/81 (79%), Positives = 71/81 (87%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDDD Sbjct: 531 ELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDDD 590 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 591 SPKKKNTNMLKKIGVLWKKNH 611 >ref|XP_015937995.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis duranensis] ref|XP_020986088.1| interactor of constitutive active ROPs 2, chloroplastic isoform X2 [Arachis duranensis] Length = 611 Score = 137 bits (344), Expect = 9e-35 Identities = 64/81 (79%), Positives = 71/81 (87%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDDD Sbjct: 531 ELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDDD 590 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 591 SPKKKNTNMLKKIGVLWKKNH 611 >ref|XP_016184883.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis ipaensis] ref|XP_016184885.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis ipaensis] Length = 623 Score = 137 bits (344), Expect = 9e-35 Identities = 64/81 (79%), Positives = 71/81 (87%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDDD Sbjct: 543 ELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDDD 602 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 603 SPKKKNTNMLKKIGVLWKKNH 623 >ref|XP_015937991.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis duranensis] ref|XP_015937993.1| interactor of constitutive active ROPs 2, chloroplastic isoform X1 [Arachis duranensis] Length = 623 Score = 137 bits (344), Expect = 9e-35 Identities = 64/81 (79%), Positives = 71/81 (87%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK +LS+GNNGK+VERTGSLD+ +NSI GK++SPYSEDTDDD Sbjct: 543 ELRRLKVQSDQWRKAAEAAATILSAGNNGKVVERTGSLDNNFNSITGKMTSPYSEDTDDD 602 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 603 SPKKKNTNMLKKIGVLWKKNH 623 >ref|XP_007144532.1| hypothetical protein PHAVU_007G163800g [Phaseolus vulgaris] gb|ESW16526.1| hypothetical protein PHAVU_007G163800g [Phaseolus vulgaris] Length = 609 Score = 136 bits (343), Expect = 1e-34 Identities = 65/81 (80%), Positives = 69/81 (85%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSP+SEDTDDD Sbjct: 529 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSNYNSIGAKMSSPFSEDTDDD 588 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 589 SPKKKNTNMLKKIGVLWKKNH 609 >dbj|GAU26745.1| hypothetical protein TSUD_317430 [Trifolium subterraneum] Length = 584 Score = 136 bits (342), Expect = 1e-34 Identities = 67/83 (80%), Positives = 71/83 (85%), Gaps = 2/83 (2%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNS--INGKLSSPYSEDTD 176 ELRRLKVQSDQWRK M+SSGNNGKIVERTG LDSGYN+ + K+SSPYSEDTD Sbjct: 501 ELRRLKVQSDQWRKAAEAAAAMISSGNNGKIVERTGLLDSGYNNSIVGNKMSSPYSEDTD 560 Query: 177 DDSPKKKNTTMLKKIGVLWKKNH 245 DDSPKKKNTTMLKKIGVLWKKNH Sbjct: 561 DDSPKKKNTTMLKKIGVLWKKNH 583 >ref|XP_006594118.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] ref|XP_006594119.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] gb|KRH19815.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19816.1| hypothetical protein GLYMA_13G137200 [Glycine max] Length = 623 Score = 136 bits (342), Expect = 2e-34 Identities = 65/81 (80%), Positives = 69/81 (85%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSPYSE+TDDD Sbjct: 543 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDDD 602 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 603 SPKKKNTNMLKKIGVLWKKNH 623 >ref|XP_003542499.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006594115.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006594116.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006594117.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] gb|KRH19817.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19818.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19819.1| hypothetical protein GLYMA_13G137200 [Glycine max] gb|KRH19820.1| hypothetical protein GLYMA_13G137200 [Glycine max] Length = 624 Score = 136 bits (342), Expect = 2e-34 Identities = 65/81 (80%), Positives = 69/81 (85%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSPYSE+TDDD Sbjct: 544 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDDD 603 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 604 SPKKKNTNMLKKIGVLWKKNH 624 >gb|KHN48324.1| Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 625 Score = 136 bits (342), Expect = 2e-34 Identities = 65/81 (80%), Positives = 69/81 (85%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK M+S+GNNGK VERTGSLDS YNSI K+SSPYSE+TDDD Sbjct: 545 ELRRLKVQSDQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNSITAKMSSPYSENTDDD 604 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 605 SPKKKNTNMLKKIGVLWKKNH 625 >ref|XP_017405929.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] ref|XP_017405930.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] ref|XP_017405932.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] ref|XP_017405933.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Vigna angularis] gb|KOM25842.1| hypothetical protein LR48_Vigan197s001100 [Vigna angularis] dbj|BAT95895.1| hypothetical protein VIGAN_08272500 [Vigna angularis var. angularis] Length = 622 Score = 135 bits (341), Expect = 2e-34 Identities = 64/81 (79%), Positives = 70/81 (86%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQS+QWRK M+S+GNNGK VERTGSLDS YN+I+ K+SSPYSEDTDDD Sbjct: 542 ELRRLKVQSEQWRKAAEAAAAMISAGNNGKFVERTGSLDSSYNTISAKMSSPYSEDTDDD 601 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 602 SPKKKNTNMLKKIGVLWKKNH 622 >ref|XP_019428539.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 624 Score = 133 bits (335), Expect = 2e-33 Identities = 66/85 (77%), Positives = 72/85 (84%), Gaps = 4/85 (4%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNS----INGKLSSPYSED 170 ELRRLKVQSDQWRK MLS+GNNGK+VERTGSLDS YNS INGK+SSPYSED Sbjct: 540 ELRRLKVQSDQWRKAAEAAAAMLSNGNNGKLVERTGSLDSSYNSSYSSINGKMSSPYSED 599 Query: 171 TDDDSPKKKNTTMLKKIGVLWKKNH 245 TDD+SPKKKN+ MLKKIGVLWKK+H Sbjct: 600 TDDESPKKKNSNMLKKIGVLWKKSH 624 >ref|XP_019428537.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] ref|XP_019428538.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] gb|OIV90488.1| hypothetical protein TanjilG_18672 [Lupinus angustifolius] Length = 625 Score = 133 bits (335), Expect = 2e-33 Identities = 66/85 (77%), Positives = 72/85 (84%), Gaps = 4/85 (4%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNS----INGKLSSPYSED 170 ELRRLKVQSDQWRK MLS+GNNGK+VERTGSLDS YNS INGK+SSPYSED Sbjct: 541 ELRRLKVQSDQWRKAAEAAAAMLSNGNNGKLVERTGSLDSSYNSSYSSINGKMSSPYSED 600 Query: 171 TDDDSPKKKNTTMLKKIGVLWKKNH 245 TDD+SPKKKN+ MLKKIGVLWKK+H Sbjct: 601 TDDESPKKKNSNMLKKIGVLWKKSH 625 >gb|PNY06087.1| interactor of constitutive active ROPs-like protein [Trifolium pratense] Length = 668 Score = 132 bits (333), Expect = 4e-33 Identities = 68/83 (81%), Positives = 72/83 (86%), Gaps = 2/83 (2%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYN-SING-KLSSPYSEDTD 176 ELRRLKVQSDQWRK M+SSGNNGKIVERTG ++SGYN SI G K+SSPYSEDTD Sbjct: 585 ELRRLKVQSDQWRKAAEAAAAMISSGNNGKIVERTGLIESGYNNSIPGNKMSSPYSEDTD 644 Query: 177 DDSPKKKNTTMLKKIGVLWKKNH 245 DDSPKKKNTTMLKKIGVLWKKNH Sbjct: 645 DDSPKKKNTTMLKKIGVLWKKNH 667 >ref|XP_019433286.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Lupinus angustifolius] Length = 448 Score = 130 bits (327), Expect = 5e-33 Identities = 62/81 (76%), Positives = 66/81 (81%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDTDDD 182 ELRRLKVQSDQWRK MLS GNNGK VER G LDS +NS+ GK++SPYSED DDD Sbjct: 367 ELRRLKVQSDQWRKAAEAAASMLSPGNNGKFVERNGLLDSSFNSVTGKVNSPYSEDMDDD 426 Query: 183 SPKKKNTTMLKKIGVLWKKNH 245 SPKKKNT MLKKIGVLWKKNH Sbjct: 427 SPKKKNTNMLKKIGVLWKKNH 447 >ref|XP_006588764.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] gb|KRH32408.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32409.1| hypothetical protein GLYMA_10G049600 [Glycine max] Length = 625 Score = 132 bits (331), Expect = 6e-33 Identities = 65/82 (79%), Positives = 68/82 (82%), Gaps = 1/82 (1%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDT-DD 179 ELRRLKVQSDQWRK M+SSGNNGK VERTGSLDS YNS+ K+SSPYSEDT DD Sbjct: 544 ELRRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTAKMSSPYSEDTDDD 603 Query: 180 DSPKKKNTTMLKKIGVLWKKNH 245 DSPKKKNT MLKKIGVLWKK H Sbjct: 604 DSPKKKNTNMLKKIGVLWKKTH 625 >gb|KHN39107.1| Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 626 Score = 132 bits (331), Expect = 6e-33 Identities = 65/82 (79%), Positives = 68/82 (82%), Gaps = 1/82 (1%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDT-DD 179 ELRRLKVQSDQWRK M+SSGNNGK VERTGSLDS YNS+ K+SSPYSEDT DD Sbjct: 545 ELRRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTAKMSSPYSEDTDDD 604 Query: 180 DSPKKKNTTMLKKIGVLWKKNH 245 DSPKKKNT MLKKIGVLWKK H Sbjct: 605 DSPKKKNTNMLKKIGVLWKKTH 626 >ref|XP_006588759.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588760.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588761.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588762.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_006588763.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618467.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618468.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618469.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] ref|XP_014618470.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] gb|KRH32410.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32411.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32412.1| hypothetical protein GLYMA_10G049600 [Glycine max] gb|KRH32413.1| hypothetical protein GLYMA_10G049600 [Glycine max] Length = 626 Score = 132 bits (331), Expect = 6e-33 Identities = 65/82 (79%), Positives = 68/82 (82%), Gaps = 1/82 (1%) Frame = +3 Query: 3 ELRRLKVQSDQWRKXXXXXXXMLSSGNNGKIVERTGSLDSGYNSINGKLSSPYSEDT-DD 179 ELRRLKVQSDQWRK M+SSGNNGK VERTGSLDS YNS+ K+SSPYSEDT DD Sbjct: 545 ELRRLKVQSDQWRKAAEAAAAMISSGNNGKFVERTGSLDSSYNSVTAKMSSPYSEDTDDD 604 Query: 180 DSPKKKNTTMLKKIGVLWKKNH 245 DSPKKKNT MLKKIGVLWKK H Sbjct: 605 DSPKKKNTNMLKKIGVLWKKTH 626