BLASTX nr result
ID: Astragalus22_contig00027472
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00027472 (446 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593468.1| transmembrane protein, putative [Medicago tr... 59 4e-09 gb|KHN08574.1| hypothetical protein glysoja_014339 [Glycine soja] 55 1e-07 ref|XP_003601584.1| transmembrane protein, putative [Medicago tr... 53 1e-06 gb|OIV93183.1| hypothetical protein TanjilG_20845 [Lupinus angus... 53 3e-06 gb|KHN07308.1| hypothetical protein glysoja_027398 [Glycine soja... 51 6e-06 >ref|XP_003593468.1| transmembrane protein, putative [Medicago truncatula] gb|AES63719.1| transmembrane protein, putative [Medicago truncatula] Length = 59 Score = 59.3 bits (142), Expect = 4e-09 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = -1 Query: 299 PIPKRGQVKLGIVLGLANSVACIISRTTSCAAAPSHLT 186 PIP+RGQVKLGIVLGLANSV CI TTSC AAPSHLT Sbjct: 24 PIPRRGQVKLGIVLGLANSVVCIF--TTSC-AAPSHLT 58 >gb|KHN08574.1| hypothetical protein glysoja_014339 [Glycine soja] Length = 59 Score = 55.5 bits (132), Expect = 1e-07 Identities = 34/62 (54%), Positives = 39/62 (62%), Gaps = 1/62 (1%) Frame = -1 Query: 368 LRGGMNMMKINXXXXXXXXXXXRPIPKRGQVKLGIVLGLANSVACIISR-TTSCAAAPSH 192 + GGM IN RPIPKRGQVK+ IVLGLA+S+A I SR TTSC A P H Sbjct: 1 MAGGM----INDGKSFPRRFSGRPIPKRGQVKVAIVLGLAHSLAAIFSRTTTSCVAPPHH 56 Query: 191 LT 186 L+ Sbjct: 57 LS 58 >ref|XP_003601584.1| transmembrane protein, putative [Medicago truncatula] ref|XP_013461194.1| transmembrane protein, putative [Medicago truncatula] ref|XP_013461195.1| transmembrane protein, putative [Medicago truncatula] gb|AES71835.1| transmembrane protein, putative [Medicago truncatula] gb|KEH35228.1| transmembrane protein, putative [Medicago truncatula] gb|KEH35229.1| transmembrane protein, putative [Medicago truncatula] Length = 65 Score = 53.1 bits (126), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 299 PIPKRGQVKLGIVLGLANSVACIISRTTSCAA 204 PIPKRGQV +GIVLGLANSV CI R+ SCAA Sbjct: 26 PIPKRGQVMVGIVLGLANSVVCIFIRSISCAA 57 >gb|OIV93183.1| hypothetical protein TanjilG_20845 [Lupinus angustifolius] Length = 89 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/43 (58%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +1 Query: 217 VVREIMQATELANPNTIPSFTCPRFGIGRPD-ILPRNLLPPLI 342 ++RE ++ATELA P TIP+ TCP FGIGRP+ ++ LLPP I Sbjct: 16 LLREKIEATELARPTTIPTLTCPLFGIGRPEHLIGMLLLPPFI 58 >gb|KHN07308.1| hypothetical protein glysoja_027398 [Glycine soja] gb|KRH49962.1| hypothetical protein GLYMA_07G191400 [Glycine max] Length = 64 Score = 51.2 bits (121), Expect = 6e-06 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 2/39 (5%) Frame = -1 Query: 299 PIPKRGQVKLGIVLGLANSVACIISRT--TSCAAAPSHL 189 PIPKRGQVK+GIV+GLANSVA I SR+ T A P+HL Sbjct: 24 PIPKRGQVKVGIVVGLANSVASIFSRSRATRGCATPTHL 62