BLASTX nr result
ID: Astragalus22_contig00027338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00027338 (364 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KYP46617.1| Speckle-type POZ protein [Cajanus cajan] 54 5e-06 ref|XP_020235788.1| BTB/POZ and TAZ domain-containing protein 1-... 54 5e-06 ref|XP_020235787.1| BTB/POZ and TAZ domain-containing protein 1-... 54 5e-06 ref|XP_019414255.1| PREDICTED: BTB/POZ and TAZ domain-containing... 54 5e-06 ref|XP_016189729.1| BTB/POZ and TAZ domain-containing protein 1 ... 54 7e-06 >gb|KYP46617.1| Speckle-type POZ protein [Cajanus cajan] Length = 331 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/54 (48%), Positives = 33/54 (61%) Frame = +3 Query: 3 CKVPLCRQIQLKTQKENKDDDVMWILLVRKVXXXXXXXXXXXXXRKWDEEIKLE 164 CKVPLCRQI++K ++EN+ DD W +LVRKV RK DEE + E Sbjct: 278 CKVPLCRQIRMKKEEENRKDDARWKVLVRKVALAKAMSSLALPKRKRDEETRPE 331 >ref|XP_020235788.1| BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Cajanus cajan] Length = 333 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/54 (48%), Positives = 33/54 (61%) Frame = +3 Query: 3 CKVPLCRQIQLKTQKENKDDDVMWILLVRKVXXXXXXXXXXXXXRKWDEEIKLE 164 CKVPLCRQI++K ++EN+ DD W +LVRKV RK DEE + E Sbjct: 280 CKVPLCRQIRMKKEEENRKDDARWKVLVRKVALAKAMSSLALPKRKRDEETRPE 333 >ref|XP_020235787.1| BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Cajanus cajan] Length = 335 Score = 54.3 bits (129), Expect = 5e-06 Identities = 26/54 (48%), Positives = 33/54 (61%) Frame = +3 Query: 3 CKVPLCRQIQLKTQKENKDDDVMWILLVRKVXXXXXXXXXXXXXRKWDEEIKLE 164 CKVPLCRQI++K ++EN+ DD W +LVRKV RK DEE + E Sbjct: 282 CKVPLCRQIRMKKEEENRKDDARWKVLVRKVALAKAMSSLALPKRKRDEETRPE 335 >ref|XP_019414255.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Lupinus angustifolius] gb|OIV98182.1| hypothetical protein TanjilG_11579 [Lupinus angustifolius] Length = 341 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/52 (53%), Positives = 31/52 (59%) Frame = +3 Query: 3 CKVPLCRQIQLKTQKENKDDDVMWILLVRKVXXXXXXXXXXXXXRKWDEEIK 158 CKVPLCRQIQLK Q+ENK D W LL RKV RK +EEI+ Sbjct: 276 CKVPLCRQIQLKMQQENKKVDAKWKLLARKVASVKAMSSLSVPKRKRNEEIR 327 >ref|XP_016189729.1| BTB/POZ and TAZ domain-containing protein 1 [Arachis ipaensis] Length = 350 Score = 53.9 bits (128), Expect = 7e-06 Identities = 27/53 (50%), Positives = 31/53 (58%) Frame = +3 Query: 3 CKVPLCRQIQLKTQKENKDDDVMWILLVRKVXXXXXXXXXXXXXRKWDEEIKL 161 CKVPLCRQIQLK Q+E + DD W LL +KV RK DEE K+ Sbjct: 285 CKVPLCRQIQLKMQQEKRKDDSRWKLLAKKVASARVISSLSLPKRKRDEETKV 337