BLASTX nr result
ID: Astragalus22_contig00027290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00027290 (811 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013469398.1| XS domain protein [Medicago truncatula] >gi|... 72 2e-10 >ref|XP_013469398.1| XS domain protein [Medicago truncatula] gb|KEH43436.1| XS domain protein [Medicago truncatula] Length = 906 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/49 (73%), Positives = 39/49 (79%) Frame = -3 Query: 809 CIVCGRRSVFFSMMLFY*MELFSKHIESGVP*YLTYRLSQVHMGSFLGS 663 CIVCGRRSVFFS+MLFY ME F KHI SG P YLT R SQ+H+ FLGS Sbjct: 847 CIVCGRRSVFFSIMLFYQMEYFYKHIASGGPYYLTCRWSQLHVVLFLGS 895