BLASTX nr result
ID: Astragalus22_contig00026992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00026992 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAY55548.1| hypothetical protein CUMW_165020 [Citrus unshiu] 52 8e-06 >dbj|GAY55548.1| hypothetical protein CUMW_165020 [Citrus unshiu] Length = 92 Score = 52.4 bits (124), Expect = 8e-06 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = +1 Query: 1 GPPPMNKAMATNLQALGYTSNMQFEF*HFNSIPHIL-ATLF 120 GPPPMNKAMA +L+ LGYT MQF+F F+ +P IL TLF Sbjct: 40 GPPPMNKAMAAHLKDLGYTREMQFQFGAFDELPPILDVTLF 80