BLASTX nr result
ID: Astragalus22_contig00026901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00026901 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU21574.1| hypothetical protein TSUD_35370 [Trifolium subte... 55 1e-06 >dbj|GAU21574.1| hypothetical protein TSUD_35370 [Trifolium subterraneum] Length = 158 Score = 55.1 bits (131), Expect = 1e-06 Identities = 26/52 (50%), Positives = 37/52 (71%) Frame = -2 Query: 405 EENRVKELTIKLHEIMKAGKVPKDLGVDELKEIDYAISLKLKEIDGKLIEAK 250 ++NR KE+TI++ E MK ++P DL V +LKE D I LKEI+ K++EAK Sbjct: 105 QDNREKEMTIRMIEYMKNKQLPDDLSVPDLKEFDKLIEKNLKEIENKIVEAK 156