BLASTX nr result
ID: Astragalus22_contig00026804
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00026804 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013446382.1| cytochrome P450 family protein [Medicago tru... 57 8e-07 ref|XP_013446381.1| cytochrome P450 family protein [Medicago tru... 57 8e-07 ref|XP_013446383.1| cytochrome P450 family protein [Medicago tru... 57 8e-07 ref|XP_003629401.2| cytochrome P450 family protein [Medicago tru... 57 9e-07 ref|XP_020238265.1| cytochrome P450 90A1-like isoform X2 [Cajanu... 56 3e-06 ref|XP_020238264.1| cytochrome P450 90A1-like isoform X1 [Cajanu... 56 3e-06 gb|KYP43762.1| Cytochrome P450 716B1 family [Cajanus cajan] 56 3e-06 gb|POE96559.1| cytochrome p450 [Quercus suber] 55 7e-06 ref|XP_023923745.1| cytochrome P450 90A1-like [Quercus suber] 55 7e-06 ref|XP_007156078.1| hypothetical protein PHAVU_003G256500g [Phas... 55 7e-06 ref|XP_003548874.1| PREDICTED: abscisic acid 8'-hydroxylase 3-li... 55 7e-06 >ref|XP_013446382.1| cytochrome P450 family protein [Medicago truncatula] gb|KEH20409.1| cytochrome P450 family protein [Medicago truncatula] Length = 386 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SPGDFLQSML+RD P S+KLDDSEI+DNLLTL Sbjct: 262 SPGDFLQSMLQRDSFPASEKLDDSEIMDNLLTL 294 >ref|XP_013446381.1| cytochrome P450 family protein [Medicago truncatula] gb|KEH20408.1| cytochrome P450 family protein [Medicago truncatula] Length = 394 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SPGDFLQSML+RD P S+KLDDSEI+DNLLTL Sbjct: 262 SPGDFLQSMLQRDSFPASEKLDDSEIMDNLLTL 294 >ref|XP_013446383.1| cytochrome P450 family protein [Medicago truncatula] gb|KEH20410.1| cytochrome P450 family protein [Medicago truncatula] Length = 427 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SPGDFLQSML+RD P S+KLDDSEI+DNLLTL Sbjct: 262 SPGDFLQSMLQRDSFPASEKLDDSEIMDNLLTL 294 >ref|XP_003629401.2| cytochrome P450 family protein [Medicago truncatula] gb|AET03877.2| cytochrome P450 family protein [Medicago truncatula] Length = 492 Score = 57.4 bits (137), Expect = 9e-07 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SPGDFLQSML+RD P S+KLDDSEI+DNLLTL Sbjct: 262 SPGDFLQSMLQRDSFPASEKLDDSEIMDNLLTL 294 >ref|XP_020238265.1| cytochrome P450 90A1-like isoform X2 [Cajanus cajan] Length = 493 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SP DFLQSML+RD LP S+KLDDSEI+DNLLTL Sbjct: 263 SPEDFLQSMLQRDSLPASEKLDDSEIMDNLLTL 295 >ref|XP_020238264.1| cytochrome P450 90A1-like isoform X1 [Cajanus cajan] Length = 494 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SP DFLQSML+RD LP S+KLDDSEI+DNLLTL Sbjct: 264 SPEDFLQSMLQRDSLPASEKLDDSEIMDNLLTL 296 >gb|KYP43762.1| Cytochrome P450 716B1 family [Cajanus cajan] Length = 494 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SP DFLQSML+RD LP S+KLDDSEI+DNLLTL Sbjct: 263 SPEDFLQSMLQRDSLPASEKLDDSEIMDNLLTL 295 >gb|POE96559.1| cytochrome p450 [Quercus suber] Length = 456 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SP DFLQSML+RD P S+KLDDSEI+DNLLTL Sbjct: 262 SPEDFLQSMLQRDSYPSSEKLDDSEIMDNLLTL 294 >ref|XP_023923745.1| cytochrome P450 90A1-like [Quercus suber] Length = 485 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 SP DFLQSML+RD P S+KLDDSEI+DNLLTL Sbjct: 262 SPEDFLQSMLQRDSYPSSEKLDDSEIMDNLLTL 294 >ref|XP_007156078.1| hypothetical protein PHAVU_003G256500g [Phaseolus vulgaris] gb|ESW28072.1| hypothetical protein PHAVU_003G256500g [Phaseolus vulgaris] Length = 494 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 +P DFLQSML+RD LP S+KLDDSEI+DNLLTL Sbjct: 264 TPEDFLQSMLQRDSLPASEKLDDSEIMDNLLTL 296 >ref|XP_003548874.1| PREDICTED: abscisic acid 8'-hydroxylase 3-like [Glycine max] gb|KHN22762.1| Cytochrome P450 716B1 [Glycine soja] gb|KRH08174.1| hypothetical protein GLYMA_16G133800 [Glycine max] Length = 494 Score = 54.7 bits (130), Expect = 7e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 101 SPGDFLQSMLKRDPLPDSQKLDDSEIVDNLLTL 3 +P DFLQSML+RD LP S+KLDDSEI+DNLLTL Sbjct: 264 TPEDFLQSMLQRDSLPASEKLDDSEIMDNLLTL 296