BLASTX nr result
ID: Astragalus22_contig00026597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00026597 (652 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55576.1| hypothetical protein [Rosa rugosa] 49 3e-06 >gb|AFP55576.1| hypothetical protein [Rosa rugosa] Length = 237 Score = 48.5 bits (114), Expect(2) = 3e-06 Identities = 25/64 (39%), Positives = 38/64 (59%) Frame = +1 Query: 82 VKMNSDVAFNKATGVGYIGIICRDNKGSVLTASSHHFFASSPLSAETYGLREAASLAHSL 261 V++N+D + +++ G I I RD++G+VL + A SP++AE LREA LA Sbjct: 34 VRINTDACWFQSSLSGAIAAIARDSRGAVLGGKAFRILAPSPMAAEALALREAVCLAMDF 93 Query: 262 HLGE 273 LGE Sbjct: 94 TLGE 97 Score = 30.8 bits (68), Expect(2) = 3e-06 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +2 Query: 254 IPYIWVNRKGNGVAHEIVQLASKDLLCGHWISTPP 358 + + W++R N AH + L + + W+ PP Sbjct: 138 VSWSWISRSANQAAHLVASLVHRGVCSSDWVQNPP 172