BLASTX nr result
ID: Astragalus22_contig00026047
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00026047 (302 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007516878.1| hypothetical protein GlmaxMp29 (mitochondrio... 87 6e-20 dbj|GAU42732.1| hypothetical protein TSUD_287870 [Trifolium subt... 84 5e-19 gb|KRH33087.1| hypothetical protein GLYMA_10G098600 [Glycine max] 85 5e-19 ref|XP_013442826.1| hypothetical protein MTR_0082s0100 [Medicago... 78 9e-16 gb|PNX59206.1| hypothetical protein L195_g051299, partial [Trifo... 63 3e-11 gb|PNY12288.1| hypothetical protein L195_g008914 [Trifolium prat... 52 3e-07 ref|XP_003622905.1| hypothetical protein MTR_7g057090 [Medicago ... 50 8e-06 >ref|YP_007516878.1| hypothetical protein GlmaxMp29 (mitochondrion) [Glycine max] gb|AFR34346.1| hypothetical protein GlmaxMp29 (mitochondrion) [Glycine max] Length = 106 Score = 86.7 bits (213), Expect = 6e-20 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 68 MELLDVAQCC*KLTTKKLCVELQPLRVGHGATASDAPHHCG 190 +ELLDVAQCC KLTTKKLCVELQPLRVGHGATASDAPHHCG Sbjct: 46 LELLDVAQCCYKLTTKKLCVELQPLRVGHGATASDAPHHCG 86 >dbj|GAU42732.1| hypothetical protein TSUD_287870 [Trifolium subterraneum] Length = 94 Score = 84.0 bits (206), Expect = 5e-19 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +2 Query: 68 MELLDVAQCC*KLTTKKLCVELQPLRVGHGATASDAPHHCGY 193 +ELLDVAQCC KLTTKKLCVELQPLRVG GATASDAPHHCG+ Sbjct: 22 LELLDVAQCCYKLTTKKLCVELQPLRVGDGATASDAPHHCGW 63 >gb|KRH33087.1| hypothetical protein GLYMA_10G098600 [Glycine max] Length = 123 Score = 84.7 bits (208), Expect = 5e-19 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -1 Query: 197 SYIRNGVGRQRLLPRGQLEGAEVRRKAFWLLIFSSTELHPTAPLCLL 57 S RNGVGRQRLLPRGQLEGAEVRR+AFWLLI+SSTELHPTAP+ L+ Sbjct: 44 SSCRNGVGRQRLLPRGQLEGAEVRRRAFWLLIYSSTELHPTAPVLLV 90 >ref|XP_013442826.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] gb|KEH16851.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] Length = 172 Score = 77.8 bits (190), Expect = 9e-16 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -1 Query: 197 SYIRNGVGRQRLLPRGQLEGAEVRRKAFWLLIFSSTELHPTAPLCLL 57 S RNGVGRQRLLPR QLEGAEVRR+AFW LI+SSTE HPTAP+ L+ Sbjct: 44 SSCRNGVGRQRLLPRRQLEGAEVRRRAFWFLIYSSTEQHPTAPVLLV 90 >gb|PNX59206.1| hypothetical protein L195_g051299, partial [Trifolium pratense] Length = 48 Score = 62.8 bits (151), Expect = 3e-11 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 190 SAMVWGVRGCCPVANSKGLKFDAKLFGC 107 +AMVWGVRGCCPVANSKGLKFDA+LFGC Sbjct: 21 AAMVWGVRGCCPVANSKGLKFDAELFGC 48 >gb|PNY12288.1| hypothetical protein L195_g008914 [Trifolium pratense] Length = 36 Score = 52.4 bits (124), Expect = 3e-07 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = -2 Query: 190 SAMVWGVRGCCPVANSKGLKFDAKL 116 +AMVWGVRGCCPVAN KGLKFDA+L Sbjct: 7 AAMVWGVRGCCPVANLKGLKFDAEL 31 >ref|XP_003622905.1| hypothetical protein MTR_7g057090 [Medicago truncatula] gb|AES79123.1| hypothetical protein MTR_7g057090 [Medicago truncatula] Length = 104 Score = 50.4 bits (119), Expect = 8e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 83 VAQCC*KLTTKKLCVELQPLRVGHGATASDAPHHCG 190 V CC KLT KKL V+LQPL+VG GAT DA HHCG Sbjct: 68 VVGCCYKLTDKKLSVKLQPLQVGDGATTYDA-HHCG 102