BLASTX nr result
ID: Astragalus22_contig00025727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025727 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023545085.1| CDK5RAP3-like protein isoform X1 [Cucurbita ... 72 2e-11 ref|XP_022967759.1| CDK5RAP3-like protein isoform X1 [Cucurbita ... 72 2e-11 ref|XP_022928745.1| CDK5RAP3-like protein isoform X1 [Cucurbita ... 72 2e-11 ref|XP_007145663.1| hypothetical protein PHAVU_007G257900g [Phas... 71 3e-11 dbj|BAT96424.1| hypothetical protein VIGAN_08336300 [Vigna angul... 71 3e-11 ref|XP_014514891.1| CDK5RAP3-like protein [Vigna radiata var. ra... 71 3e-11 ref|XP_017415611.1| PREDICTED: CDK5RAP3-like protein [Vigna angu... 71 3e-11 ref|XP_020971663.1| CDK5RAP3-like protein [Arachis ipaensis] 71 3e-11 dbj|GAU45773.1| hypothetical protein TSUD_24370 [Trifolium subte... 71 3e-11 ref|XP_015949881.1| CDK5RAP3-like protein [Arachis duranensis] 71 4e-11 ref|XP_003535845.1| PREDICTED: CDK5RAP3-like protein isoform X2 ... 71 4e-11 ref|XP_003519054.1| PREDICTED: CDK5RAP3-like protein [Glycine ma... 71 4e-11 ref|XP_006588907.1| PREDICTED: CDK5RAP3-like protein isoform X1 ... 71 4e-11 ref|XP_012087741.1| CDK5RAP3-like protein [Jatropha curcas] >gi|... 71 4e-11 ref|XP_010520055.1| PREDICTED: CDK5RAP3-like protein [Tarenaya h... 70 6e-11 emb|CBI30039.3| unnamed protein product, partial [Vitis vinifera] 70 7e-11 ref|XP_004497929.1| PREDICTED: CDK5RAP3-like protein [Cicer arie... 70 8e-11 emb|CAN63789.1| hypothetical protein VITISV_000289 [Vitis vinifera] 70 8e-11 ref|XP_010653907.1| PREDICTED: CDK5RAP3-like protein [Vitis vini... 70 8e-11 ref|XP_010036472.1| PREDICTED: CDK5RAP3-like protein [Eucalyptus... 70 1e-10 >ref|XP_023545085.1| CDK5RAP3-like protein isoform X1 [Cucurbita pepo subsp. pepo] Length = 557 Score = 71.6 bits (174), Expect = 2e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 ADDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 3 ADDIRNLPIDITFSRLGEWLVDRKRVPADWRKRL 36 >ref|XP_022967759.1| CDK5RAP3-like protein isoform X1 [Cucurbita maxima] Length = 557 Score = 71.6 bits (174), Expect = 2e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 ADDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 3 ADDIRNLPIDITFSRLGEWLVDRKRVPADWRKRL 36 >ref|XP_022928745.1| CDK5RAP3-like protein isoform X1 [Cucurbita moschata] Length = 557 Score = 71.6 bits (174), Expect = 2e-11 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 ADDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 3 ADDIRNLPIDITFSRLGEWLVDRKRVPADWRKRL 36 >ref|XP_007145663.1| hypothetical protein PHAVU_007G257900g [Phaseolus vulgaris] gb|ESW17657.1| hypothetical protein PHAVU_007G257900g [Phaseolus vulgaris] Length = 549 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 +DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 4 SDDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >dbj|BAT96424.1| hypothetical protein VIGAN_08336300 [Vigna angularis var. angularis] Length = 554 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 +DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 4 SDDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_014514891.1| CDK5RAP3-like protein [Vigna radiata var. radiata] Length = 554 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 +DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 4 SDDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_017415611.1| PREDICTED: CDK5RAP3-like protein [Vigna angularis] gb|KOM34124.1| hypothetical protein LR48_Vigan02g027400 [Vigna angularis] Length = 554 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 +DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 4 SDDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_020971663.1| CDK5RAP3-like protein [Arachis ipaensis] Length = 556 Score = 71.2 bits (173), Expect = 3e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >dbj|GAU45773.1| hypothetical protein TSUD_24370 [Trifolium subterraneum] Length = 564 Score = 71.2 bits (173), Expect = 3e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_015949881.1| CDK5RAP3-like protein [Arachis duranensis] Length = 516 Score = 70.9 bits (172), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 5 DDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_003535845.1| PREDICTED: CDK5RAP3-like protein isoform X2 [Glycine max] gb|KHN28753.1| CDK5RAP3-like protein [Glycine soja] gb|KRH32986.1| hypothetical protein GLYMA_10G091600 [Glycine max] Length = 554 Score = 70.9 bits (172), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 5 DDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_003519054.1| PREDICTED: CDK5RAP3-like protein [Glycine max] gb|KHN07243.1| CDK5RAP3-like protein [Glycine soja] gb|KRH71906.1| hypothetical protein GLYMA_02G176900 [Glycine max] Length = 554 Score = 70.9 bits (172), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 5 DDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_006588907.1| PREDICTED: CDK5RAP3-like protein isoform X1 [Glycine max] gb|KRH32987.1| hypothetical protein GLYMA_10G091600 [Glycine max] Length = 555 Score = 70.9 bits (172), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DD+RNLPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 5 DDVRNLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >ref|XP_012087741.1| CDK5RAP3-like protein [Jatropha curcas] gb|KDP24600.1| hypothetical protein JCGZ_25516 [Jatropha curcas] Length = 570 Score = 70.9 bits (172), Expect = 4e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPADWRKRI 37 >ref|XP_010520055.1| PREDICTED: CDK5RAP3-like protein [Tarenaya hassleriana] Length = 562 Score = 70.5 bits (171), Expect = 6e-11 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = +2 Query: 410 ADDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 ADD+R+LPIDITFSRLGEWLV+RKRVPADWRKRV Sbjct: 4 ADDVRSLPIDITFSRLGEWLVDRKRVPADWRKRV 37 >emb|CBI30039.3| unnamed protein product, partial [Vitis vinifera] Length = 561 Score = 70.1 bits (170), Expect = 7e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPADWRKRL 37 >ref|XP_004497929.1| PREDICTED: CDK5RAP3-like protein [Cicer arietinum] Length = 564 Score = 70.1 bits (170), Expect = 8e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVP+DWRKRV Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPSDWRKRV 37 >emb|CAN63789.1| hypothetical protein VITISV_000289 [Vitis vinifera] Length = 570 Score = 70.1 bits (170), Expect = 8e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPADWRKRL 37 >ref|XP_010653907.1| PREDICTED: CDK5RAP3-like protein [Vitis vinifera] Length = 570 Score = 70.1 bits (170), Expect = 8e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DDIRNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 5 DDIRNLPIDITFSRLGEWLVDRKRVPADWRKRL 37 >ref|XP_010036472.1| PREDICTED: CDK5RAP3-like protein [Eucalyptus grandis] gb|KCW48084.1| hypothetical protein EUGRSUZ_K01826 [Eucalyptus grandis] Length = 553 Score = 69.7 bits (169), Expect = 1e-10 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +2 Query: 413 DDIRNLPIDITFSRLGEWLVNRKRVPADWRKRV 511 DD+RNLPIDITFSRLGEWLV+RKRVPADWRKR+ Sbjct: 5 DDVRNLPIDITFSRLGEWLVDRKRVPADWRKRL 37