BLASTX nr result
ID: Astragalus22_contig00025628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025628 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNY03964.1| NAP1 [Trifolium pratense] 58 8e-07 ref|XP_004505301.1| PREDICTED: protein NAP1 [Cicer arietinum] 58 8e-07 dbj|GAU45022.1| hypothetical protein TSUD_94570 [Trifolium subte... 57 2e-06 ref|XP_015960225.1| LOW QUALITY PROTEIN: protein NAP1 [Arachis d... 57 2e-06 ref|XP_016198240.1| protein NAP1 [Arachis ipaensis] 57 2e-06 ref|XP_019434843.1| PREDICTED: protein NAP1 isoform X2 [Lupinus ... 56 5e-06 gb|OIV89323.1| hypothetical protein TanjilG_23286 [Lupinus angus... 56 5e-06 ref|XP_019434842.1| PREDICTED: protein NAP1 isoform X1 [Lupinus ... 56 5e-06 ref|XP_020225947.1| LOW QUALITY PROTEIN: protein NAP1-like [Caja... 56 5e-06 gb|KYP54953.1| Protein NAP1 [Cajanus cajan] 56 5e-06 >gb|PNY03964.1| NAP1 [Trifolium pratense] Length = 1174 Score = 58.2 bits (139), Expect = 8e-07 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDYGASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1134 PLDYGASRNKVKSVESSASGSTGPSPLPRFAVSRSGPLAYK 1174 >ref|XP_004505301.1| PREDICTED: protein NAP1 [Cicer arietinum] Length = 1382 Score = 58.2 bits (139), Expect = 8e-07 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDYGASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1342 PLDYGASRNKVKSVEGSTSGSTGPSPLPRFAVSRSGPLAYK 1382 >dbj|GAU45022.1| hypothetical protein TSUD_94570 [Trifolium subterraneum] Length = 1154 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDYGA+RNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1114 PLDYGANRNKVKSVESSASGSSGPSPLPRFAVSRSGPLAYK 1154 >ref|XP_015960225.1| LOW QUALITY PROTEIN: protein NAP1 [Arachis duranensis] Length = 1388 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDYGASRN+VKSVE LPRFAVSRSGP+AYK Sbjct: 1348 PLDYGASRNRVKSVEGSTSGSTGPSPLPRFAVSRSGPLAYK 1388 >ref|XP_016198240.1| protein NAP1 [Arachis ipaensis] Length = 1390 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDYGASRN+VKSVE LPRFAVSRSGP+AYK Sbjct: 1350 PLDYGASRNRVKSVEGSTSGSTGPSPLPRFAVSRSGPLAYK 1390 >ref|XP_019434843.1| PREDICTED: protein NAP1 isoform X2 [Lupinus angustifolius] Length = 1187 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDY ASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1147 PLDYSASRNKVKSVEGSASGSTGPSPLPRFAVSRSGPLAYK 1187 >gb|OIV89323.1| hypothetical protein TanjilG_23286 [Lupinus angustifolius] Length = 1363 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDY ASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1323 PLDYSASRNKVKSVEGSASGSTGPSPLPRFAVSRSGPLAYK 1363 >ref|XP_019434842.1| PREDICTED: protein NAP1 isoform X1 [Lupinus angustifolius] Length = 1390 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDY ASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1350 PLDYSASRNKVKSVEGSASGSTGPSPLPRFAVSRSGPLAYK 1390 >ref|XP_020225947.1| LOW QUALITY PROTEIN: protein NAP1-like [Cajanus cajan] Length = 1414 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDY ASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1374 PLDYSASRNKVKSVEGSTSGSTGPSPLPRFAVSRSGPLAYK 1414 >gb|KYP54953.1| Protein NAP1 [Cajanus cajan] Length = 1434 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/41 (68%), Positives = 29/41 (70%) Frame = +3 Query: 3 PLDYGASRNKVKSVEXXXXXXXXXXXLPRFAVSRSGPIAYK 125 PLDY ASRNKVKSVE LPRFAVSRSGP+AYK Sbjct: 1394 PLDYSASRNKVKSVEGSTSGSTGPSPLPRFAVSRSGPLAYK 1434