BLASTX nr result
ID: Astragalus22_contig00025573
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025573 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pir||T06502 hypothetical protein 91 - garden pea chloroplast >gi... 80 4e-17 gb|AFK34392.1| unknown [Lotus japonicus] 68 2e-12 gb|KJB09789.1| hypothetical protein B456_001G166200 [Gossypium r... 55 2e-07 ref|XP_013442826.1| hypothetical protein MTR_0082s0100 [Medicago... 55 8e-07 >pir||T06502 hypothetical protein 91 - garden pea chloroplast emb|CAA25831.1| hypothetical protein (chloroplast) [Pisum sativum] Length = 91 Score = 80.1 bits (196), Expect = 4e-17 Identities = 45/76 (59%), Positives = 45/76 (59%), Gaps = 17/76 (22%) Frame = +3 Query: 87 MYAIRFIPWDCSSIGQSTALSRRKLRVRAPSVPMDINTIK-----------------KIL 215 MY IR PWDCSSIGQSTALSRRKLRVR PSVPMD N IK KI Sbjct: 1 MYTIRLFPWDCSSIGQSTALSRRKLRVRVPSVPMDTNPIKKIKYQWISCMKGNKNKNKIS 60 Query: 216 FLTGTPPFFYFFFSLR 263 FLTG P F F LR Sbjct: 61 FLTGIPFFLSFLVCLR 76 >gb|AFK34392.1| unknown [Lotus japonicus] Length = 74 Score = 67.8 bits (164), Expect = 2e-12 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +1 Query: 106 FPGIVVQLVRAPPCQGGSYGFEPRQSRWI*IQSKK 210 FPGIVVQLVRAPPCQGGS GFE RQSRWI IQSKK Sbjct: 7 FPGIVVQLVRAPPCQGGSCGFESRQSRWIQIQSKK 41 >gb|KJB09789.1| hypothetical protein B456_001G166200 [Gossypium raimondii] Length = 100 Score = 55.5 bits (132), Expect = 2e-07 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 106 FPGIVVQLVRAPPCQGGSYGFEPRQSR 186 FPGIVVQ VRAPPCQGGS GFEPRQSR Sbjct: 70 FPGIVVQSVRAPPCQGGSCGFEPRQSR 96 >ref|XP_013442826.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] gb|KEH16851.1| hypothetical protein MTR_0082s0100 [Medicago truncatula] Length = 172 Score = 55.5 bits (132), Expect = 8e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +1 Query: 79 VRICMLYDLFPGIVVQLVRAPPCQGGSYGFEPRQSR 186 +RI + PGIVVQ VRAPPCQGGS GFEPRQSR Sbjct: 133 IRIAVHLIFIPGIVVQSVRAPPCQGGSCGFEPRQSR 168