BLASTX nr result
ID: Astragalus22_contig00025571
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025571 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023537156.1| exportin-7-like isoform X4 [Cucurbita pepo s... 64 4e-09 ref|XP_023002036.1| exportin-7-like isoform X4 [Cucurbita maxima] 64 4e-09 ref|XP_022951379.1| exportin-7-like isoform X4 [Cucurbita moschata] 64 4e-09 ref|XP_022131546.1| exportin-7 isoform X4 [Momordica charantia] 64 4e-09 ref|XP_023545994.1| exportin-7-like isoform X2 [Cucurbita pepo s... 64 4e-09 ref|XP_023545991.1| exportin-7-like isoform X1 [Cucurbita pepo s... 64 4e-09 ref|XP_022131545.1| exportin-7 isoform X3 [Momordica charantia] 64 4e-09 ref|XP_011657454.1| PREDICTED: exportin-7 isoform X5 [Cucumis sa... 64 4e-09 ref|XP_008445380.1| PREDICTED: exportin-7 isoform X4 [Cucumis melo] 64 4e-09 ref|XP_023537154.1| exportin-7-like isoform X2 [Cucurbita pepo s... 64 4e-09 ref|XP_023537155.1| exportin-7-like isoform X3 [Cucurbita pepo s... 64 4e-09 ref|XP_023002035.1| exportin-7-like isoform X3 [Cucurbita maxima] 64 4e-09 ref|XP_023002034.1| exportin-7-like isoform X2 [Cucurbita maxima] 64 4e-09 ref|XP_022997048.1| exportin-7-like isoform X3 [Cucurbita maxima] 64 4e-09 ref|XP_022997047.1| exportin-7-like isoform X2 [Cucurbita maxima] 64 4e-09 ref|XP_022962003.1| exportin-7-like isoform X2 [Cucurbita moschata] 64 4e-09 ref|XP_022962005.1| exportin-7-like isoform X3 [Cucurbita moschata] 64 4e-09 ref|XP_022951377.1| exportin-7-like isoform X2 [Cucurbita moschata] 64 4e-09 ref|XP_022951378.1| exportin-7-like isoform X3 [Cucurbita moschata] 64 4e-09 ref|XP_022131544.1| exportin-7 isoform X2 [Momordica charantia] 64 4e-09 >ref|XP_023537156.1| exportin-7-like isoform X4 [Cucurbita pepo subsp. pepo] Length = 917 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 599 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 643 >ref|XP_023002036.1| exportin-7-like isoform X4 [Cucurbita maxima] Length = 917 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 599 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 643 >ref|XP_022951379.1| exportin-7-like isoform X4 [Cucurbita moschata] Length = 917 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 599 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 643 >ref|XP_022131546.1| exportin-7 isoform X4 [Momordica charantia] Length = 1012 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 560 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 604 >ref|XP_023545994.1| exportin-7-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 1014 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_023545991.1| exportin-7-like isoform X1 [Cucurbita pepo subsp. pepo] ref|XP_023545992.1| exportin-7-like isoform X1 [Cucurbita pepo subsp. pepo] Length = 1015 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 599 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 643 >ref|XP_022131545.1| exportin-7 isoform X3 [Momordica charantia] Length = 1047 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 595 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 639 >ref|XP_011657454.1| PREDICTED: exportin-7 isoform X5 [Cucumis sativus] Length = 1047 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 595 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 639 >ref|XP_008445380.1| PREDICTED: exportin-7 isoform X4 [Cucumis melo] Length = 1047 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 595 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 639 >ref|XP_023537154.1| exportin-7-like isoform X2 [Cucurbita pepo subsp. pepo] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_023537155.1| exportin-7-like isoform X3 [Cucurbita pepo subsp. pepo] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_023002035.1| exportin-7-like isoform X3 [Cucurbita maxima] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_023002034.1| exportin-7-like isoform X2 [Cucurbita maxima] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022997048.1| exportin-7-like isoform X3 [Cucurbita maxima] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022997047.1| exportin-7-like isoform X2 [Cucurbita maxima] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022962003.1| exportin-7-like isoform X2 [Cucurbita moschata] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022962005.1| exportin-7-like isoform X3 [Cucurbita moschata] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022951377.1| exportin-7-like isoform X2 [Cucurbita moschata] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022951378.1| exportin-7-like isoform X3 [Cucurbita moschata] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642 >ref|XP_022131544.1| exportin-7 isoform X2 [Momordica charantia] Length = 1050 Score = 64.3 bits (155), Expect = 4e-09 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -3 Query: 191 SEEVVDHTLSLFLELAYGYMTGKLLWKLDTVKFIARQMNSRQKWSF 54 SEEV+DHTLSLFLELA GYMTGKLL KLDTVKFI ++R+++ F Sbjct: 598 SEEVIDHTLSLFLELASGYMTGKLLLKLDTVKFIVAN-HTREQFPF 642