BLASTX nr result
ID: Astragalus22_contig00025454
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025454 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34485.1| unknown [Medicago truncatula] 82 1e-16 gb|AFK45220.1| unknown [Medicago truncatula] 82 3e-16 ref|XP_020994976.1| probable UDP-arabinose 4-epimerase 1 isoform... 83 4e-16 ref|XP_020975468.1| probable UDP-arabinose 4-epimerase 1 isoform... 83 4e-16 ref|XP_017239437.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 80 6e-16 ref|XP_011100374.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum... 83 6e-16 gb|EPS61540.1| hypothetical protein M569_13257, partial [Genlise... 82 6e-16 ref|XP_016711200.1| PREDICTED: probable UDP-arabinose 4-epimeras... 83 7e-16 ref|XP_020204686.1| UDP-arabinose 4-epimerase 1-like [Cajanus ca... 83 7e-16 ref|XP_022873553.1| UDP-arabinose 4-epimerase 1-like [Olea europ... 80 8e-16 ref|XP_018507134.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_008378354.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_018507135.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_011085445.1| probable UDP-arabinose 4-epimerase 3 [Sesamu... 83 9e-16 gb|KZV25392.1| UDP-arabinose 4-epimerase 1-like [Dorcoceras hygr... 83 9e-16 ref|XP_017248419.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_009377955.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_009377954.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_008342292.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 ref|XP_015880910.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 83 9e-16 >gb|AFK34485.1| unknown [Medicago truncatula] Length = 207 Score = 82.4 bits (202), Expect = 1e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGTRVS*P 170 +++ YFNVIGS+ EGRLGEA RP+LRE GRISGACFD+ARGI+PGLK TGT + P Sbjct: 37 VMILRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGIMPGLKVTGTDYNTP 93 >gb|AFK45220.1| unknown [Medicago truncatula] Length = 263 Score = 82.4 bits (202), Expect = 3e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGTRVS*P 170 +++ YFNVIGS+ EGRLGEA RP+LRE GRISGACFD+ARGI+PGLK TGT + P Sbjct: 93 VMILRYFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGIMPGLKVTGTDYNTP 149 >ref|XP_020994976.1| probable UDP-arabinose 4-epimerase 1 isoform X2 [Arachis duranensis] Length = 309 Score = 82.8 bits (203), Expect = 4e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 135 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 186 >ref|XP_020975468.1| probable UDP-arabinose 4-epimerase 1 isoform X2 [Arachis ipaensis] Length = 309 Score = 82.8 bits (203), Expect = 4e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 135 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 186 >ref|XP_017239437.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] gb|KZN01081.1| hypothetical protein DCAR_009835 [Daucus carota subsp. sativus] Length = 181 Score = 80.1 bits (196), Expect = 6e-16 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = -2 Query: 325 YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGTRVS 176 YFNVIGS+ EGRLGEA P+LREQGRISGACFD+ARGIIPGLK GT S Sbjct: 11 YFNVIGSDPEGRLGEAPPPELREQGRISGACFDAARGIIPGLKIRGTDYS 60 >ref|XP_011100374.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011100377.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011100378.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_020555023.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] Length = 389 Score = 83.2 bits (204), Expect = 6e-16 Identities = 41/55 (74%), Positives = 47/55 (85%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGTRVS 176 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT S Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKIRGTDYS 275 >gb|EPS61540.1| hypothetical protein M569_13257, partial [Genlisea aurea] Length = 282 Score = 82.0 bits (201), Expect = 6e-16 Identities = 41/59 (69%), Positives = 50/59 (84%) Frame = -2 Query: 346 SFILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGTRVS*P 170 +F++L+ YFNVIGS+ EGRLGEA RP+LRE GRISGACFD+ARG+IPGLK GT + P Sbjct: 106 AFMILR-YFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGVIPGLKVRGTDYNTP 163 >ref|XP_016711200.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 [Gossypium hirsutum] ref|XP_016711201.1| PREDICTED: probable UDP-arabinose 4-epimerase 3 [Gossypium hirsutum] Length = 412 Score = 83.2 bits (204), Expect = 7e-16 Identities = 42/59 (71%), Positives = 49/59 (83%) Frame = -2 Query: 361 SHSLYSFILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 S +L I++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPG+K GT Sbjct: 235 SKNLDMAIMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGIKVKGT 293 >ref|XP_020204686.1| UDP-arabinose 4-epimerase 1-like [Cajanus cajan] gb|KYP37603.1| UDP-arabinose 4-epimerase 1 [Cajanus cajan] Length = 416 Score = 83.2 bits (204), Expect = 7e-16 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 I++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 242 IMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 293 >ref|XP_022873553.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] Length = 195 Score = 80.1 bits (196), Expect = 8e-16 Identities = 42/57 (73%), Positives = 47/57 (82%) Frame = -2 Query: 355 SLYSFILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 SL++FI YFNVIGS+ EGRLGEA RP+LRE GRISGACFD+ARGII GLK GT Sbjct: 17 SLFNFIFR--YFNVIGSDPEGRLGEAPRPELREHGRISGACFDAARGIISGLKVRGT 71 >ref|XP_018507134.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Pyrus x bretschneideri] Length = 389 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 272 >ref|XP_008378354.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Malus domestica] Length = 389 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 272 >ref|XP_018507135.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Pyrus x bretschneideri] Length = 390 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 222 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 273 >ref|XP_011085445.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_011085446.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_011085447.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_020551553.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] ref|XP_020551554.1| probable UDP-arabinose 4-epimerase 3 [Sesamum indicum] Length = 390 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKIRGT 272 >gb|KZV25392.1| UDP-arabinose 4-epimerase 1-like [Dorcoceras hygrometricum] Length = 391 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 217 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKIRGT 268 >ref|XP_017248419.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] ref|XP_017248420.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] ref|XP_017248421.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Daucus carota subsp. sativus] gb|KZM99304.1| hypothetical protein DCAR_013334 [Daucus carota subsp. sativus] Length = 391 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKIRGT 272 >ref|XP_009377955.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X2 [Pyrus x bretschneideri] Length = 392 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 272 >ref|XP_009377954.1| PREDICTED: UDP-arabinose 4-epimerase 1-like isoform X1 [Pyrus x bretschneideri] Length = 392 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 272 >ref|XP_008342292.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Malus domestica] Length = 392 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVRGT 272 >ref|XP_015880910.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Ziziphus jujuba] Length = 395 Score = 82.8 bits (203), Expect = 9e-16 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = -2 Query: 340 ILLK*YFNVIGSNLEGRLGEALRPKLREQGRISGACFDSARGIIPGLKWTGT 185 +++ YFNVIGS+ EGRLGEA RP+LREQGRISGACFD+ARGIIPGLK GT Sbjct: 221 VMILRYFNVIGSDPEGRLGEAPRPELREQGRISGACFDAARGIIPGLKVKGT 272