BLASTX nr result
ID: Astragalus22_contig00025453
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025453 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016163303.1| RNA-binding KH domain-containing protein RCF... 73 7e-13 ref|XP_016163302.1| RNA-binding KH domain-containing protein RCF... 73 2e-12 ref|XP_015934360.1| RNA-binding KH domain-containing protein RCF... 71 5e-12 ref|XP_015934359.1| RNA-binding KH domain-containing protein RCF... 71 1e-11 gb|KRH64404.1| hypothetical protein GLYMA_04G234100 [Glycine max] 70 2e-11 gb|KRH53531.1| hypothetical protein GLYMA_06G130700 [Glycine max] 70 2e-11 ref|XP_007136507.1| hypothetical protein PHAVU_009G051000g [Phas... 70 2e-11 ref|XP_003523354.1| PREDICTED: KH domain-containing protein At4g... 70 2e-11 ref|XP_003526723.1| PREDICTED: KH domain-containing protein At4g... 70 2e-11 ref|XP_004502677.1| PREDICTED: KH domain-containing protein At4g... 70 2e-11 dbj|GAU22914.1| hypothetical protein TSUD_377260 [Trifolium subt... 69 4e-11 gb|KYP60975.1| KH domain-containing protein At4g18375 family [Ca... 69 5e-11 ref|XP_014519016.1| RNA-binding KH domain-containing protein RCF... 69 6e-11 ref|XP_020222635.1| RNA-binding KH domain-containing protein RCF... 69 6e-11 ref|XP_017422606.1| PREDICTED: KH domain-containing protein HEN4... 69 6e-11 gb|KOM41367.1| hypothetical protein LR48_Vigan04g156500 [Vigna a... 69 6e-11 gb|PON72037.1| Polyribonucleotide nucleotidyltransferase [Parasp... 69 8e-11 gb|PNY18013.1| KH domain-containing protein at4g18375-like prote... 67 2e-10 ref|XP_023923197.1| RNA-binding KH domain-containing protein RCF... 67 2e-10 ref|XP_015886653.1| PREDICTED: KH domain-containing protein At4g... 67 2e-10 >ref|XP_016163303.1| RNA-binding KH domain-containing protein RCF3 isoform X2 [Arachis ipaensis] Length = 274 Score = 73.2 bits (178), Expect = 7e-13 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 MDRSRSKRNYYY+QDYDSDTLARTRPRYNHHY Sbjct: 1 MDRSRSKRNYYYDQDYDSDTLARTRPRYNHHY 32 >ref|XP_016163302.1| RNA-binding KH domain-containing protein RCF3 isoform X1 [Arachis ipaensis] Length = 660 Score = 73.2 bits (178), Expect = 2e-12 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 MDRSRSKRNYYY+QDYDSDTLARTRPRYNHHY Sbjct: 1 MDRSRSKRNYYYDQDYDSDTLARTRPRYNHHY 32 >ref|XP_015934360.1| RNA-binding KH domain-containing protein RCF3 isoform X2 [Arachis duranensis] Length = 274 Score = 70.9 bits (172), Expect = 5e-12 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 MDRSRSKRNYYY+QDYDSDTLAR RPRYNHHY Sbjct: 1 MDRSRSKRNYYYDQDYDSDTLARIRPRYNHHY 32 >ref|XP_015934359.1| RNA-binding KH domain-containing protein RCF3 isoform X1 [Arachis duranensis] Length = 661 Score = 70.9 bits (172), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 MDRSRSKRNYYY+QDYDSDTLAR RPRYNHHY Sbjct: 1 MDRSRSKRNYYYDQDYDSDTLARIRPRYNHHY 32 >gb|KRH64404.1| hypothetical protein GLYMA_04G234100 [Glycine max] Length = 560 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+TLARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETLARTRPRYNHHY 32 >gb|KRH53531.1| hypothetical protein GLYMA_06G130700 [Glycine max] Length = 637 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+TLARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETLARTRPRYNHHY 32 >ref|XP_007136507.1| hypothetical protein PHAVU_009G051000g [Phaseolus vulgaris] gb|ESW08501.1| hypothetical protein PHAVU_009G051000g [Phaseolus vulgaris] Length = 644 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYYEQDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYEQDYDSETVARTRPRYNHHY 32 >ref|XP_003523354.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] gb|KRH64403.1| hypothetical protein GLYMA_04G234100 [Glycine max] Length = 644 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+TLARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETLARTRPRYNHHY 32 >ref|XP_003526723.1| PREDICTED: KH domain-containing protein At4g18375-like [Glycine max] gb|KRH53532.1| hypothetical protein GLYMA_06G130700 [Glycine max] Length = 647 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+TLARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETLARTRPRYNHHY 32 >ref|XP_004502677.1| PREDICTED: KH domain-containing protein At4g18375 [Cicer arietinum] Length = 648 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+TLARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETLARTRPRYNHHY 32 >dbj|GAU22914.1| hypothetical protein TSUD_377260 [Trifolium subterraneum] Length = 653 Score = 69.3 bits (168), Expect = 4e-11 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETMARTRPRYNHHY 32 >gb|KYP60975.1| KH domain-containing protein At4g18375 family [Cajanus cajan] Length = 556 Score = 68.9 bits (167), Expect = 5e-11 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVARTRPRYNHHY 32 >ref|XP_014519016.1| RNA-binding KH domain-containing protein RCF3 [Vigna radiata var. radiata] Length = 644 Score = 68.9 bits (167), Expect = 6e-11 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVARTRPRYNHHY 32 >ref|XP_020222635.1| RNA-binding KH domain-containing protein RCF3 [Cajanus cajan] Length = 645 Score = 68.9 bits (167), Expect = 6e-11 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVARTRPRYNHHY 32 >ref|XP_017422606.1| PREDICTED: KH domain-containing protein HEN4 [Vigna angularis] dbj|BAT78854.1| hypothetical protein VIGAN_02160200 [Vigna angularis var. angularis] Length = 645 Score = 68.9 bits (167), Expect = 6e-11 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVARTRPRYNHHY 32 >gb|KOM41367.1| hypothetical protein LR48_Vigan04g156500 [Vigna angularis] Length = 679 Score = 68.9 bits (167), Expect = 6e-11 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVARTRPRYNHHY 32 >gb|PON72037.1| Polyribonucleotide nucleotidyltransferase [Parasponia andersonii] Length = 678 Score = 68.6 bits (166), Expect = 8e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYYEQDYDS+T+ RTRPRYNHHY Sbjct: 1 MERSRSKRNYYYEQDYDSETVVRTRPRYNHHY 32 >gb|PNY18013.1| KH domain-containing protein at4g18375-like protein, partial [Trifolium pratense] Length = 641 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKR+YYY+QDYDS+T+ARTRPRYNHHY Sbjct: 1 MERSRSKRSYYYDQDYDSETMARTRPRYNHHY 32 >ref|XP_023923197.1| RNA-binding KH domain-containing protein RCF3 [Quercus suber] gb|POE97159.1| rna-binding kh domain-containing protein rcf3 [Quercus suber] Length = 661 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ RTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVGRTRPRYNHHY 32 >ref|XP_015886653.1| PREDICTED: KH domain-containing protein At4g18375-like [Ziziphus jujuba] ref|XP_015865824.1| PREDICTED: KH domain-containing protein At4g18375 [Ziziphus jujuba] Length = 671 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 142 MDRSRSKRNYYYEQDYDSDTLARTRPRYNHHY 47 M+RSRSKRNYYY+QDYDS+T+ RTRPRYNHHY Sbjct: 1 MERSRSKRNYYYDQDYDSETVGRTRPRYNHHY 32