BLASTX nr result
ID: Astragalus22_contig00025253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00025253 (305 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013468835.1| import inner membrane translocase subunit TI... 72 5e-13 dbj|GAU40606.1| hypothetical protein TSUD_28120 [Trifolium subte... 64 6e-10 gb|PNX75538.1| hypothetical protein L195_g031475 [Trifolium prat... 58 5e-09 ref|XP_004495481.1| PREDICTED: probable mitochondrial import inn... 57 2e-07 >ref|XP_013468835.1| import inner membrane translocase subunit TIM21, putative [Medicago truncatula] gb|KEH42872.1| import inner membrane translocase subunit TIM21, putative [Medicago truncatula] Length = 248 Score = 72.0 bits (175), Expect = 5e-13 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +1 Query: 142 MFRIRRILSHRALAAWTRNAPCSSSEICSLSRCNAPNLPPPSFPGVGIAENHGS 303 MFRIRRILS+RALA+ TRNA SSS+ SL R NAP LPPP F VGIAEN+GS Sbjct: 1 MFRIRRILSYRALASCTRNALSSSSQPRSLPRSNAPILPPPFFLDVGIAENYGS 54 >dbj|GAU40606.1| hypothetical protein TSUD_28120 [Trifolium subterraneum] Length = 251 Score = 63.9 bits (154), Expect = 6e-10 Identities = 41/59 (69%), Positives = 44/59 (74%), Gaps = 5/59 (8%) Frame = +1 Query: 142 MFRIRRILSHRALAAWTRNAPCSSSEICSLS----RCNAPNLPPPSFPGVG-IAENHGS 303 MFRIRRI S+RALA+ TRNA SSSE SLS R + P LPPPSF GVG IAENHGS Sbjct: 1 MFRIRRIFSYRALASCTRNA-LSSSETRSLSHSLPRSHPPILPPPSFLGVGRIAENHGS 58 >gb|PNX75538.1| hypothetical protein L195_g031475 [Trifolium pratense] Length = 81 Score = 58.2 bits (139), Expect = 5e-09 Identities = 35/53 (66%), Positives = 37/53 (69%), Gaps = 3/53 (5%) Frame = +1 Query: 154 RRILSHRALAAWTRNAPCSSSEIC---SLSRCNAPNLPPPSFPGVGIAENHGS 303 RRI S+RALA+ TRNA SS SLSR AP LPPPSF GVGIAENH S Sbjct: 3 RRIFSYRALASCTRNALSSSETRSLPHSLSRSIAPILPPPSFLGVGIAENHRS 55 >ref|XP_004495481.1| PREDICTED: probable mitochondrial import inner membrane translocase subunit TIM21 [Cicer arietinum] Length = 243 Score = 57.0 bits (136), Expect = 2e-07 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = +1 Query: 142 MFRIRRILSHRALAAWTRNAPCSSSEICSLSRCNAPNLPPPSFPGVGIAENHGS 303 MFRIRR+LS+RAL + TRNA SSSE SL R + PPSF GVGI ENHGS Sbjct: 1 MFRIRRMLSYRALLSCTRNAH-SSSETRSLIRSH-----PPSFLGVGITENHGS 48