BLASTX nr result
ID: Astragalus22_contig00024633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00024633 (447 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB66287.1| hypothetical protein B456_010G135200 [Gossypium r... 57 4e-07 ref|XP_012085782.1| biotin carboxyl carrier protein of acetyl-Co... 58 5e-07 ref|XP_012085781.1| biotin carboxyl carrier protein of acetyl-Co... 58 6e-07 gb|KJB66288.1| hypothetical protein B456_010G135200 [Gossypium r... 57 7e-07 gb|KJB66289.1| hypothetical protein B456_010G135200 [Gossypium r... 57 9e-07 ref|XP_021890923.1| biotin carboxyl carrier protein of acetyl-Co... 57 1e-06 gb|PPS05453.1| hypothetical protein GOBAR_AA15202 [Gossypium bar... 57 1e-06 gb|KHG03380.1| Biotin carboxyl carrier of acetyl-CoA carboxylase... 57 1e-06 ref|XP_017646162.1| PREDICTED: biotin carboxyl carrier protein o... 57 1e-06 ref|XP_016683408.1| PREDICTED: biotin carboxyl carrier protein o... 57 1e-06 ref|XP_012451021.1| PREDICTED: biotin carboxyl carrier protein o... 57 1e-06 ref|XP_007029252.1| PREDICTED: biotin carboxyl carrier protein o... 56 2e-06 gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het... 56 2e-06 ref|XP_020996671.1| biotin carboxyl carrier protein of acetyl-Co... 56 2e-06 ref|XP_020977562.1| biotin carboxyl carrier protein of acetyl-Co... 56 2e-06 ref|XP_016194023.1| biotin carboxyl carrier protein of acetyl-Co... 56 3e-06 ref|XP_015961982.1| biotin carboxyl carrier protein of acetyl-Co... 56 3e-06 ref|NP_001314655.1| biotin carboxyl carrier protein of acetyl-Co... 55 4e-06 ref|XP_021283415.1| biotin carboxyl carrier protein of acetyl-Co... 55 5e-06 ref|XP_021283414.1| biotin carboxyl carrier protein of acetyl-Co... 55 5e-06 >gb|KJB66287.1| hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 161 Score = 56.6 bits (135), Expect = 4e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 133 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 161 >ref|XP_012085782.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Jatropha curcas] ref|XP_012085783.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X3 [Jatropha curcas] gb|ADN52613.1| acetyl-CoA carboxylase BCCP subunit [Jatropha curcas] gb|KDP26884.1| hypothetical protein JCGZ_18042 [Jatropha curcas] Length = 285 Score = 57.8 bits (138), Expect = 5e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGKSVSVDMPLFVI+P Sbjct: 257 ADQSGTIVEILAEDGKSVSVDMPLFVIEP 285 >ref|XP_012085781.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic isoform X1 [Jatropha curcas] Length = 316 Score = 57.8 bits (138), Expect = 6e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGKSVSVDMPLFVI+P Sbjct: 288 ADQSGTIVEILAEDGKSVSVDMPLFVIEP 316 >gb|KJB66288.1| hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 201 Score = 56.6 bits (135), Expect = 7e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 173 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 201 >gb|KJB66289.1| hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 215 Score = 56.6 bits (135), Expect = 9e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 187 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 215 >ref|XP_021890923.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic [Carica papaya] Length = 283 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK VSVDMPLFVIQP Sbjct: 255 ADQSGTIVEILAEDGKPVSVDMPLFVIQP 283 >gb|PPS05453.1| hypothetical protein GOBAR_AA15202 [Gossypium barbadense] Length = 241 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 213 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 241 >gb|KHG03380.1| Biotin carboxyl carrier of acetyl-CoA carboxylase 1, chloroplastic -like protein [Gossypium arboreum] Length = 412 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -3 Query: 358 SADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 +ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 383 AADQSGTIVEILAEDGKAVSVDMPLFVIEP 412 >ref|XP_017646162.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Gossypium arboreum] Length = 282 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 254 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 282 >ref|XP_016683408.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Gossypium hirsutum] Length = 282 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 254 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 282 >ref|XP_012451021.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Gossypium raimondii] gb|KJB66284.1| hypothetical protein B456_010G135200 [Gossypium raimondii] Length = 282 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK+VSVDMPLFVI+P Sbjct: 254 ADQSGTIVEILAEDGKAVSVDMPLFVIEP 282 >ref|XP_007029252.1| PREDICTED: biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Theobroma cacao] gb|EOY09754.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 1 [Theobroma cacao] Length = 279 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEIL EDGKSVSVDMPLFVI+P Sbjct: 251 ADQSGTIVEILVEDGKSVSVDMPLFVIEP 279 >gb|EOY09756.1| Biotin carboxyl carrier protein subunit of of Het-ACCase (BCCP1), putative isoform 3 [Theobroma cacao] Length = 310 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEIL EDGKSVSVDMPLFVI+P Sbjct: 282 ADQSGTIVEILVEDGKSVSVDMPLFVIEP 310 >ref|XP_020996671.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Arachis duranensis] Length = 261 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK VSVDMPLFVI+P Sbjct: 233 ADQSGTIVEILAEDGKPVSVDMPLFVIEP 261 >ref|XP_020977562.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Arachis ipaensis] Length = 261 Score = 55.8 bits (133), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK VSVDMPLFVI+P Sbjct: 233 ADQSGTIVEILAEDGKPVSVDMPLFVIEP 261 >ref|XP_016194023.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Arachis ipaensis] gb|ACO53610.1| biotin carboxyl carrier protein 1-2 [Arachis hypogaea] Length = 279 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK VSVDMPLFVI+P Sbjct: 251 ADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >ref|XP_015961982.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X1 [Arachis duranensis] gb|ACO53609.1| biotin carboxyl carrier protein 1-1 [Arachis hypogaea] Length = 279 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEILAEDGK VSVDMPLFVI+P Sbjct: 251 ADQSGTIVEILAEDGKPVSVDMPLFVIEP 279 >ref|NP_001314655.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic-like [Gossypium hirsutum] gb|ABU41516.1| biotin carboxyl carrier protein subunit [Gossypium hirsutum] Length = 282 Score = 55.5 bits (132), Expect = 4e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGT+VEILAEDGK+VSVDMPLFVI+P Sbjct: 254 ADQSGTMVEILAEDGKAVSVDMPLFVIEP 282 >ref|XP_021283415.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase, chloroplastic isoform X2 [Herrania umbratica] Length = 283 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEIL +DGKSVSVDMPLFVI+P Sbjct: 255 ADQSGTIVEILVDDGKSVSVDMPLFVIEP 283 >ref|XP_021283414.1| biotin carboxyl carrier protein of acetyl-CoA carboxylase 1, chloroplastic isoform X1 [Herrania umbratica] Length = 314 Score = 55.1 bits (131), Expect = 5e-06 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 355 ADQSGTIVEILAEDGKSVSVDMPLFVIQP 269 ADQSGTIVEIL +DGKSVSVDMPLFVI+P Sbjct: 286 ADQSGTIVEILVDDGKSVSVDMPLFVIEP 314