BLASTX nr result
ID: Astragalus22_contig00024467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00024467 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003610064.1| DUF4228 domain protein [Medicago truncatula]... 55 2e-06 ref|XP_003543509.1| PREDICTED: uncharacterized protein LOC100785... 55 2e-06 ref|XP_003546424.1| PREDICTED: uncharacterized protein LOC100810... 54 3e-06 gb|KHN17624.1| hypothetical protein glysoja_005821 [Glycine soja] 54 3e-06 ref|XP_003550651.1| PREDICTED: uncharacterized protein LOC100775... 54 3e-06 >ref|XP_003610064.1| DUF4228 domain protein [Medicago truncatula] gb|AES92261.1| DUF4228 domain protein [Medicago truncatula] Length = 185 Score = 55.1 bits (131), Expect = 2e-06 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 398 IGMMNGGRSPGRLKPWKPILDTITEKPINRGR*SYLQE 285 + MM+GGRSP R++ WKPILDTITEKP NR S LQE Sbjct: 143 MNMMSGGRSPCRMQSWKPILDTITEKPFNRRSESDLQE 180 >ref|XP_003543509.1| PREDICTED: uncharacterized protein LOC100785670 [Glycine max] gb|KHN22670.1| hypothetical protein glysoja_027558 [Glycine soja] gb|KRH19076.1| hypothetical protein GLYMA_13G099800 [Glycine max] Length = 171 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/41 (60%), Positives = 32/41 (78%), Gaps = 1/41 (2%) Frame = -2 Query: 398 IGMMN-GGRSPGRLKPWKPILDTITEKPINRGR*SYLQEFC 279 +GMMN GG+SP +++PWKPILDTITEKP ++ LQE C Sbjct: 131 VGMMNIGGKSPSKVQPWKPILDTITEKPFHKRTEPDLQESC 171 >ref|XP_003546424.1| PREDICTED: uncharacterized protein LOC100810460 [Glycine max] gb|KHN15328.1| hypothetical protein glysoja_026623 [Glycine soja] gb|KRH12296.1| hypothetical protein GLYMA_15G164800 [Glycine max] Length = 178 Score = 54.3 bits (129), Expect = 3e-06 Identities = 27/39 (69%), Positives = 29/39 (74%) Frame = -2 Query: 401 QIGMMNGGRSPGRLKPWKPILDTITEKPINRGR*SYLQE 285 QIGM GGRSP R++PWKPILDTI EK NR S LQE Sbjct: 138 QIGMPYGGRSPCRVRPWKPILDTIREKSFNRRSESDLQE 176 >gb|KHN17624.1| hypothetical protein glysoja_005821 [Glycine soja] Length = 170 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 398 IGMMN-GGRSPGRLKPWKPILDTITEKPINRGR*SYLQE 285 +G+MN GGRSP +++PWKPILDTITEKP ++ S LQE Sbjct: 131 VGLMNIGGRSPSKVQPWKPILDTITEKPFHKRSESDLQE 169 >ref|XP_003550651.1| PREDICTED: uncharacterized protein LOC100775396 [Glycine max] gb|KRH02807.1| hypothetical protein GLYMA_17G060200 [Glycine max] Length = 170 Score = 53.9 bits (128), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 398 IGMMN-GGRSPGRLKPWKPILDTITEKPINRGR*SYLQE 285 +G+MN GGRSP +++PWKPILDTITEKP ++ S LQE Sbjct: 131 VGLMNIGGRSPSKVQPWKPILDTITEKPFHKRSESDLQE 169