BLASTX nr result
ID: Astragalus22_contig00023939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00023939 (563 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013450901.1| hypothetical protein MTR_6g009455 [Medicago ... 57 7e-08 >ref|XP_013450901.1| hypothetical protein MTR_6g009455 [Medicago truncatula] gb|KEH24941.1| hypothetical protein MTR_6g009455 [Medicago truncatula] Length = 56 Score = 57.0 bits (136), Expect = 7e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 396 KSSNPLHKAMEYETTPAEAPPVRAAPSTPDTSIYD 292 K++ PL KAMEYETTPAE PPV+ APSTP+ IYD Sbjct: 3 KAATPLSKAMEYETTPAEMPPVKVAPSTPEPLIYD 37