BLASTX nr result
ID: Astragalus22_contig00021961
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00021961 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003602268.1| hypothetical protein MTR_3g091680 [Medicago ... 54 2e-06 dbj|GAU44055.1| hypothetical protein TSUD_399530 [Trifolium subt... 53 6e-06 >ref|XP_003602268.1| hypothetical protein MTR_3g091680 [Medicago truncatula] gb|AES72519.1| hypothetical protein MTR_3g091680 [Medicago truncatula] Length = 170 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 392 ASIYESFKQVVPWRRRKETQRKSTSKTDTV 303 ASIY+SFKQVVPWRRRKETQRK S TDT+ Sbjct: 141 ASIYDSFKQVVPWRRRKETQRKWVSITDTI 170 >dbj|GAU44055.1| hypothetical protein TSUD_399530 [Trifolium subterraneum] Length = 176 Score = 53.1 bits (126), Expect = 6e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -2 Query: 392 ASIYESFKQVVPWRRRKETQRKSTSKTDTV 303 ASIY SFKQVVPWRRRKETQRK S TDTV Sbjct: 147 ASIYGSFKQVVPWRRRKETQRKWVSITDTV 176