BLASTX nr result
ID: Astragalus22_contig00021862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00021862 (459 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004491962.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-22 ref|XP_003621602.1| PPR containing plant-like protein [Medicago ... 100 2e-21 gb|PNX73632.1| pentatricopeptide repeat-containing protein at3g2... 98 6e-21 ref|XP_020977773.1| pentatricopeptide repeat-containing protein ... 94 2e-19 ref|XP_015962584.1| pentatricopeptide repeat-containing protein ... 94 2e-19 ref|XP_006602978.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 ref|XP_003551785.1| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 gb|KHN13778.1| Pentatricopeptide repeat-containing protein [Glyc... 87 6e-17 dbj|GAU14055.1| hypothetical protein TSUD_168800 [Trifolium subt... 86 8e-17 dbj|BAT82135.1| hypothetical protein VIGAN_03209800 [Vigna angul... 86 1e-16 gb|KOM36655.1| hypothetical protein LR48_Vigan03g003600 [Vigna a... 86 1e-16 ref|XP_017417961.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-16 ref|XP_017417960.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-16 ref|XP_014498292.1| pentatricopeptide repeat-containing protein ... 86 1e-16 dbj|BAT83188.1| hypothetical protein VIGAN_04030200 [Vigna angul... 86 1e-16 ref|XP_014498291.1| pentatricopeptide repeat-containing protein ... 86 1e-16 gb|KYP76473.1| Pentatricopeptide repeat-containing protein At3g2... 86 2e-16 ref|XP_020211402.1| pentatricopeptide repeat-containing protein ... 86 2e-16 ref|XP_020211394.1| pentatricopeptide repeat-containing protein ... 86 2e-16 gb|KRH45157.1| hypothetical protein GLYMA_08G254100 [Glycine max] 84 7e-16 >ref|XP_004491962.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290 [Cicer arietinum] Length = 700 Score = 103 bits (256), Expect = 1e-22 Identities = 56/80 (70%), Positives = 62/80 (77%), Gaps = 13/80 (16%) Frame = -3 Query: 202 RETIDTSFVASKDV-------VGLIN------LEEMDENVLSSRILELSRTNKIRSAMEY 62 RE +D SFVA K++ GL+N LEEMDENVLS+RILELSRTNKIRSAMEY Sbjct: 233 REDVDESFVAEKELRRQGSKQAGLMNENGALFLEEMDENVLSNRILELSRTNKIRSAMEY 292 Query: 61 FRSMDLLGLCPNIHACNSLL 2 FRSM+L GLCPNIHACNSLL Sbjct: 293 FRSMELFGLCPNIHACNSLL 312 >ref|XP_003621602.1| PPR containing plant-like protein [Medicago truncatula] gb|AES77820.1| PPR containing plant-like protein [Medicago truncatula] Length = 613 Score = 99.8 bits (247), Expect = 2e-21 Identities = 53/76 (69%), Positives = 58/76 (76%), Gaps = 10/76 (13%) Frame = -3 Query: 199 ETIDTSFVASKDVV----------GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 E +D SFVA KD+ G+I LEEMDENVLS+RILELSRTNKIRSAMEYFRSM Sbjct: 150 EDVDVSFVAEKDLQRQGSKVVNENGVIFLEEMDENVLSNRILELSRTNKIRSAMEYFRSM 209 Query: 49 DLLGLCPNIHACNSLL 2 + GLCPN HACNSLL Sbjct: 210 KMFGLCPNNHACNSLL 225 >gb|PNX73632.1| pentatricopeptide repeat-containing protein at3g29290-like protein, partial [Trifolium pratense] Length = 494 Score = 98.2 bits (243), Expect = 6e-21 Identities = 52/80 (65%), Positives = 59/80 (73%), Gaps = 13/80 (16%) Frame = -3 Query: 202 RETIDTSFVASKDVV-------------GLINLEEMDENVLSSRILELSRTNKIRSAMEY 62 RE +D SF A K++ G + LEEMDENVLS+RILELSRTNKIRSAMEY Sbjct: 27 REDVDLSFAAEKELRHQGTEEGLLVNEDGPLFLEEMDENVLSNRILELSRTNKIRSAMEY 86 Query: 61 FRSMDLLGLCPNIHACNSLL 2 FRSM++ GLCPNIHACNSLL Sbjct: 87 FRSMEMFGLCPNIHACNSLL 106 >ref|XP_020977773.1| pentatricopeptide repeat-containing protein At3g29290 [Arachis ipaensis] Length = 626 Score = 94.0 bits (232), Expect = 2e-19 Identities = 56/101 (55%), Positives = 61/101 (60%), Gaps = 32/101 (31%) Frame = -3 Query: 208 EGRETIDTSFVASKDVV--------------------------GLIN------LEEMDEN 125 EGRE ID SFV KD+ GL+N LEE DEN Sbjct: 138 EGREGIDASFVGKKDLPPWGEVEGSRHWHSRIVDVTRSASKEKGLVNEQRALYLEETDEN 197 Query: 124 VLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 VLS+RIL LSRTNKIRSAMEYFRSM+L GLCPNIHACNSL+ Sbjct: 198 VLSNRILVLSRTNKIRSAMEYFRSMELSGLCPNIHACNSLM 238 >ref|XP_015962584.1| pentatricopeptide repeat-containing protein At3g29290 [Arachis duranensis] Length = 663 Score = 94.0 bits (232), Expect = 2e-19 Identities = 56/101 (55%), Positives = 61/101 (60%), Gaps = 32/101 (31%) Frame = -3 Query: 208 EGRETIDTSFVASKDVV--------------------------GLIN------LEEMDEN 125 EGRE ID SFV KD+ GL+N LEE DEN Sbjct: 175 EGREGIDASFVGKKDLPPWGEVEGSRHWHSGIVDVTRLASKEKGLVNEQRAIYLEETDEN 234 Query: 124 VLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 VLS+RIL LSRTNKIRSAMEYFRSM+L GLCPNIHACNSL+ Sbjct: 235 VLSNRILVLSRTNKIRSAMEYFRSMELSGLCPNIHACNSLM 275 >ref|XP_006602978.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform X2 [Glycine max] gb|KRH01437.1| hypothetical protein GLYMA_18G276600 [Glycine max] Length = 748 Score = 87.4 bits (215), Expect = 4e-17 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 6/76 (7%) Frame = -3 Query: 211 HEGRETIDTSFVASKDVVGLIN------LEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 H+ R TS ++ +GL+N LEE+DENVLS+RIL LSRTNKIRSAMEYFRSM Sbjct: 286 HDSRPVETTS--SAPQGIGLLNEHGVLFLEELDENVLSNRILVLSRTNKIRSAMEYFRSM 343 Query: 49 DLLGLCPNIHACNSLL 2 +L GL PNIHACNSL+ Sbjct: 344 ELSGLSPNIHACNSLI 359 >ref|XP_003551785.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform X1 [Glycine max] gb|KRH01438.1| hypothetical protein GLYMA_18G276600 [Glycine max] Length = 749 Score = 87.4 bits (215), Expect = 4e-17 Identities = 48/76 (63%), Positives = 57/76 (75%), Gaps = 6/76 (7%) Frame = -3 Query: 211 HEGRETIDTSFVASKDVVGLIN------LEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 H+ R TS ++ +GL+N LEE+DENVLS+RIL LSRTNKIRSAMEYFRSM Sbjct: 286 HDSRPVETTS--SAPQGIGLLNEHGVLFLEELDENVLSNRILVLSRTNKIRSAMEYFRSM 343 Query: 49 DLLGLCPNIHACNSLL 2 +L GL PNIHACNSL+ Sbjct: 344 ELSGLSPNIHACNSLI 359 >gb|KHN13778.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 749 Score = 87.0 bits (214), Expect = 6e-17 Identities = 47/76 (61%), Positives = 57/76 (75%), Gaps = 6/76 (7%) Frame = -3 Query: 211 HEGRETIDTSFVASKDVVGLIN------LEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 H ++T+ A + + GL+N LEE+DENVLS+RIL LSRTNKIRSAMEYFRSM Sbjct: 285 HRDSRPVETTSSAPQGI-GLLNEHGVLFLEELDENVLSNRILVLSRTNKIRSAMEYFRSM 343 Query: 49 DLLGLCPNIHACNSLL 2 +L GL PNIHACNSL+ Sbjct: 344 ELSGLSPNIHACNSLI 359 >dbj|GAU14055.1| hypothetical protein TSUD_168800 [Trifolium subterraneum] Length = 433 Score = 86.3 bits (212), Expect = 8e-17 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 136 MDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 MDE+VLS+RILELSRTNKIRSAMEYFRSM+L GLCPNIHACNSLL Sbjct: 1 MDEHVLSNRILELSRTNKIRSAMEYFRSMELFGLCPNIHACNSLL 45 >dbj|BAT82135.1| hypothetical protein VIGAN_03209800 [Vigna angularis var. angularis] Length = 596 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 155 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 206 >gb|KOM36655.1| hypothetical protein LR48_Vigan03g003600 [Vigna angularis] Length = 783 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 342 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 393 >ref|XP_017417961.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform X2 [Vigna angularis] Length = 784 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 344 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 395 >ref|XP_017417960.1| PREDICTED: pentatricopeptide repeat-containing protein At3g29290-like isoform X1 [Vigna angularis] Length = 785 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 344 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 395 >ref|XP_014498292.1| pentatricopeptide repeat-containing protein At3g29290 isoform X2 [Vigna radiata var. radiata] Length = 788 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 348 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 399 >dbj|BAT83188.1| hypothetical protein VIGAN_04030200 [Vigna angularis var. angularis] Length = 789 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 348 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 399 >ref|XP_014498291.1| pentatricopeptide repeat-containing protein At3g29290 isoform X1 [Vigna radiata var. radiata] Length = 789 Score = 86.3 bits (212), Expect = 1e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G I LEEMDENVLS+RI+ LSRTNKIRSAMEYFRSM+L GL PNIHACNSL+ Sbjct: 348 GAIFLEEMDENVLSNRIVVLSRTNKIRSAMEYFRSMELSGLSPNIHACNSLV 399 >gb|KYP76473.1| Pentatricopeptide repeat-containing protein At3g29290 [Cajanus cajan] Length = 637 Score = 85.5 bits (210), Expect = 2e-16 Identities = 46/76 (60%), Positives = 58/76 (76%), Gaps = 6/76 (7%) Frame = -3 Query: 211 HEGRETIDTSFVASKDVVGLIN------LEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 H +++T+ S+ + GL+N LEE+DENVLS+RIL LSRTNKIRSAMEYFRSM Sbjct: 174 HRDSRSVETTLSVSERM-GLMNEHGALFLEELDENVLSNRILVLSRTNKIRSAMEYFRSM 232 Query: 49 DLLGLCPNIHACNSLL 2 +L GL P+IHACNSL+ Sbjct: 233 ELSGLSPSIHACNSLI 248 >ref|XP_020211402.1| pentatricopeptide repeat-containing protein At3g29290 isoform X2 [Cajanus cajan] Length = 660 Score = 85.5 bits (210), Expect = 2e-16 Identities = 46/76 (60%), Positives = 58/76 (76%), Gaps = 6/76 (7%) Frame = -3 Query: 211 HEGRETIDTSFVASKDVVGLIN------LEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 H +++T+ S+ + GL+N LEE+DENVLS+RIL LSRTNKIRSAMEYFRSM Sbjct: 197 HRDSRSVETTLSVSERM-GLMNEHGALFLEELDENVLSNRILVLSRTNKIRSAMEYFRSM 255 Query: 49 DLLGLCPNIHACNSLL 2 +L GL P+IHACNSL+ Sbjct: 256 ELSGLSPSIHACNSLI 271 >ref|XP_020211394.1| pentatricopeptide repeat-containing protein At3g29290 isoform X1 [Cajanus cajan] Length = 661 Score = 85.5 bits (210), Expect = 2e-16 Identities = 46/76 (60%), Positives = 58/76 (76%), Gaps = 6/76 (7%) Frame = -3 Query: 211 HEGRETIDTSFVASKDVVGLIN------LEEMDENVLSSRILELSRTNKIRSAMEYFRSM 50 H +++T+ S+ + GL+N LEE+DENVLS+RIL LSRTNKIRSAMEYFRSM Sbjct: 197 HRDSRSVETTLSVSERM-GLMNEHGALFLEELDENVLSNRILVLSRTNKIRSAMEYFRSM 255 Query: 49 DLLGLCPNIHACNSLL 2 +L GL P+IHACNSL+ Sbjct: 256 ELSGLSPSIHACNSLI 271 >gb|KRH45157.1| hypothetical protein GLYMA_08G254100 [Glycine max] Length = 662 Score = 84.0 bits (206), Expect = 7e-16 Identities = 41/52 (78%), Positives = 46/52 (88%) Frame = -3 Query: 157 GLINLEEMDENVLSSRILELSRTNKIRSAMEYFRSMDLLGLCPNIHACNSLL 2 G + LEE+DENVLSSRIL LSRTNKIRSAMEYFRSM+L + PNIHACNSL+ Sbjct: 253 GALFLEELDENVLSSRILVLSRTNKIRSAMEYFRSMELSAISPNIHACNSLI 304