BLASTX nr result

ID: Astragalus22_contig00021669 seq

BLASTX 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Astragalus22_contig00021669
         (693 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           149,584,005 sequences; 54,822,741,787 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb|AFK38374.1| unknown [Medicago truncatula]                           95   5e-22
gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix d...    62   4e-09
ref|YP_654205.1| photosystem II M protein (chloroplast) [Oryza s...    59   4e-08
ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cres...    53   6e-08
gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum...    57   9e-08
ref|YP_001381730.1| photosystem II protein M (chloroplast) [Medi...    57   1e-07
gb|KQK85735.1| hypothetical protein SETIT_020844mg, partial [Set...    56   2e-07
gb|AFP87330.1| photosystem II protein M, partial (chloroplast) [...    55   3e-07
ref|YP_398315.1| photosystem II reaction center M protein [Lactu...    55   3e-07
ref|YP_009262745.1| photosystem II protein M (chloroplast) [Ludi...    55   3e-07
ref|YP_009403732.1| photosystem II protein M (plastid) [Isotoma ...    55   3e-07
ref|YP_008758182.1| photosystem II protein M (chloroplast) [Vera...    55   3e-07
ref|YP_009373817.1| PsbM (chloroplast) [Soliva sessilis] >gi|117...    55   3e-07
gb|AKF01761.1| photosystem II protein M (chloroplast) [Iriartea ...    55   3e-07
ref|YP_009404150.1| photosystem II protein M (plastid) [Lobelia ...    55   3e-07
ref|YP_009403880.1| photosystem II protein M (plastid) [Lobelia ...    55   3e-07
ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium...    55   3e-07
ref|YP_009427812.1| photosystem II protein M (chloroplast) [Circ...    55   5e-07
ref|YP_009154945.1| photosystem II M protein (chloroplast) [Gent...    55   5e-07
ref|YP_009136595.1| photosystem II reaction center M protein (pl...    55   5e-07

>gb|AFK38374.1| unknown [Medicago truncatula]
          Length = 52

 Score = 94.7 bits (234), Expect = 5e-22
 Identities = 43/45 (95%), Positives = 44/45 (97%)
 Frame = -1

Query: 516 FIRN*RERKHRDYGSKYSRIYSYCTLHSSSYCLFTYNLRKNGKSK 382
           FIRN RERKHRDYGS+YSRIYSYCTLHSSSYCLFTYNLRKNGKSK
Sbjct: 8   FIRNKRERKHRDYGSQYSRIYSYCTLHSSSYCLFTYNLRKNGKSK 52


>gb|ATG83018.1| photosystem II protein M (chloroplast) [Phoenix dactylifera]
          Length = 70

 Score = 61.6 bits (148), Expect = 4e-09
 Identities = 37/73 (50%), Positives = 43/73 (58%)
 Frame = -2

Query: 599 YHRDKIDTIEFTAERLNIYMGLNPXXXXXXXXXXXXXXXXXXXXILAFIATALFILVPTA 420
           YH++ I  +E T  +  I MGL+P                     LAFIATALFILVPTA
Sbjct: 3   YHQNSIHPVELTGVKFLISMGLDPELLRSKKNNEIMEVNI-----LAFIATALFILVPTA 57

Query: 419 FLLIIYVKTVSQS 381
           FLLIIYVKTVSQ+
Sbjct: 58  FLLIIYVKTVSQN 70


>ref|YP_654205.1| photosystem II M protein (chloroplast) [Oryza sativa Indica Group]
 gb|AAS46045.1| photosystem II M protein (chloroplast) [Oryza sativa Indica Group]
          Length = 68

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 26/37 (70%), Positives = 29/37 (78%)
 Frame = -1

Query: 492 KHRDYGSKYSRIYSYCTLHSSSYCLFTYNLRKNGKSK 382
           K R YGS+YSRIY YC +HSSSYCLFTY L KN + K
Sbjct: 32  KKRGYGSQYSRIYCYCIVHSSSYCLFTYYLCKNSQPK 68


>ref|YP_009409886.1| photosystem II protein M (chloroplast) [Cressa cretica]
 gb|ASJ65073.1| photosystem II protein M (chloroplast) [Cressa cretica]
          Length = 79

 Score = 53.1 bits (126), Expect(2) = 6e-08
 Identities = 27/29 (93%), Positives = 28/29 (96%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAF LIIYVKTVSQS+
Sbjct: 51  LAFIATALFILVPTAFFLIIYVKTVSQSD 79



 Score = 32.3 bits (72), Expect(2) = 6e-08
 Identities = 15/27 (55%), Positives = 20/27 (74%)
 Frame = -1

Query: 576 H*IYRRKIEHLYGIKSRSINFIRN*RE 496
           H I++RKI HLYGIKSR I  ++  R+
Sbjct: 17  HCIFKRKIYHLYGIKSRVIAKLKKRRD 43


>gb|ANF05123.1| photosystem II protein M (chloroplast) [Cynanchum auriculatum]
          Length = 50

 Score = 57.4 bits (137), Expect = 9e-08
 Identities = 26/40 (65%), Positives = 32/40 (80%)
 Frame = -1

Query: 501 RERKHRDYGSKYSRIYSYCTLHSSSYCLFTYNLRKNGKSK 382
           +++K  DYGSKYS I  YCT+HSSSY L TY+LRKN +SK
Sbjct: 11  KKKKRLDYGSKYSCICCYCTIHSSSYRLSTYHLRKNNQSK 50


>ref|YP_001381730.1| photosystem II protein M (chloroplast) [Medicago truncatula]
 ref|YP_007889855.1| photosystem II protein M (plastid) [Francoa sonchifolia]
 ref|YP_008994284.1| photosystem II protein M (plastid) [Melianthus villosus]
 ref|YP_009027139.1| photosystem II protein M [Trifolium aureum]
 ref|YP_009027063.1| photosystem II protein M [Trifolium grandiflorum]
 ref|YP_009109853.1| photosystem II protein M (chloroplast) [Trifolium glanduliferum]
 ref|YP_009109802.1| photosystem II protein M (chloroplast) [Trifolium boissieri]
 ref|YP_009109928.1| photosystem II protein M (chloroplast) [Trifolium strictum]
 ref|YP_009175757.1| photosystem II protein M (chloroplast) [Astragalus mongholicus var.
           nakaianus]
 ref|YP_009231153.1| photosystem II protein M (chloroplast) [Dipteronia sinensis]
 ref|YP_009232124.1| photosystem II protein M (chloroplast) [Acer morrisonense]
 ref|YP_009242951.1| photosystem II protein M (chloroplast) [Astragalus mongholicus]
 ref|YP_009253557.1| PsbM (chloroplast) [Senna tora]
 ref|YP_009257287.1| photosystem II protein M (chloroplast) [Acer davidii]
 ref|YP_009257707.1| photosystem II protein M (chloroplast) [Acer miaotaiense]
 ref|YP_009320360.1| photosystem II protein M (chloroplast) [Dipteronia dyeriana]
 ref|YP_009319300.1| photosystem II protein M (chloroplast) [Nepsera aquatica]
 ref|YP_009334187.1| photosystem II protein M (chloroplast) [Caragana microphylla]
 ref|YP_009351965.1| photosystem II protein M (chloroplast) [Schoepfia jasminodora]
 ref|YP_009353252.1| photosystem II protein M (chloroplast) [Passiflora edulis]
 ref|YP_009355599.1| photosystem II protein M (chloroplast) [Acer griseum]
 ref|YP_009368532.1| photosystem II protein M (chloroplast) [Acer buergerianum]
 ref|YP_009379331.1| photosystem II protein M (plastid) [Acer palmatum]
 ref|YP_009389927.1| photosystem II protein M (chloroplast) [Caragana korshinskii]
 ref|YP_009429710.1| photosystem II protein M (chloroplast) [Aesculus wangii]
 ref|YP_009464093.1| photosystem II protein M (chloroplast) [Trapa maximowiczii]
 ref|YP_009469894.1| photosystem II protein M (chloroplast) [Acer truncatum]
 gb|ABU85509.1| photosystem II protein M, partial (chloroplast) [Passiflora
           biflora]
 gb|AFJ00465.1| photosystem II protein M (plastid) [Francoa sonchifolia]
 gb|AFR59977.1| photosystem II protein M (plastid) [Medicago truncatula]
 gb|AFR60053.1| photosystem II protein M (plastid) [Medicago truncatula]
 gb|AFR60129.1| photosystem II protein M (plastid) [Medicago truncatula]
 gb|AFU93990.1| PsbM, partial (chloroplast) [Galearia maingayi]
 gb|AFU93999.1| PsbM, partial (chloroplast) [Microdesmis caseariifolia]
 gb|AFU94000.1| PsbM, partial (chloroplast) [Passiflora ciliata]
 gb|AFU94004.1| PsbM, partial (chloroplast) [Podostemum ceratophyllum]
 gb|AGO63717.1| photosystem II protein M (plastid) [Trifolium grandiflorum]
 gb|AGO63793.1| photosystem II protein M (plastid) [Trifolium aureum]
 gb|AGS13003.1| photosystem II protein M (plastid) [Melianthus villosus]
 gb|AHF71544.1| photosystem II protein M (chloroplast) [Acer buergerianum subsp.
           ningpoense]
 gb|AIJ27843.1| photosystem II protein M (chloroplast) [Trifolium boissieri]
 gb|AIJ27893.1| photosystem II protein M (chloroplast) [Trifolium glanduliferum]
 gb|AIJ28395.1| photosystem II protein M (chloroplast) [Trifolium strictum]
 gb|AJE71659.1| photosystem II protein M (plastid) [Melilotus officinalis]
 gb|AJE71730.1| photosystem II protein M (plastid) [Melilotus albus]
 gb|AJE71801.1| photosystem II protein M (plastid) [Astragalus canadensis]
 gb|AJE72014.1| photosystem II protein M (plastid) [Baptisia bracteata]
 gb|AJE72227.1| photosystem II protein M (plastid) [Trifolium campestre]
 gb|AJE72440.1| photosystem II protein M (plastid) [Baptisia alba]
 gb|ALF03746.1| PsbM (chloroplast) [Senna tora]
 gb|ALH42804.1| photosystem II protein M (chloroplast) [Astragalus mongholicus var.
           nakaianus]
 gb|ALV83987.1| photosystem II protein M (chloroplast) [Dipteronia sinensis]
 gb|AMA20492.1| photosystem II protein M (chloroplast) [Acer morrisonense]
 gb|AMA98305.1| photosystem II protein M (chloroplast) [Dipteronia dyeriana]
 gb|AMQ99214.1| photosystem II protein M (chloroplast) [Astragalus mongholicus]
 gb|ANG44561.1| photosystem II protein M (chloroplast) [Acer davidii]
 gb|ANH55573.1| photosystem II protein M (chloroplast) [Acer miaotaiense]
 gb|ANK78933.1| photosystem II protein M (chloroplast) [Astragalus membranaceus
           var. membranaceus]
 emb|CUR02613.1| psbM (chloroplast) [Acacia formidabilis]
 gb|APA18474.1| photosystem II protein M (chloroplast) [Nepsera aquatica]
 gb|APL97393.1| photosystem II protein M (chloroplast) [Caragana microphylla]
 gb|APL97469.1| photosystem II protein M (chloroplast) [Caragana korshinskii]
 gb|APL97571.1| photosystem II protein M (chloroplast) [Passiflora edulis]
 gb|AQW41682.1| photosystem II protein M (chloroplast) [Schoepfia jasminodora]
 gb|ARB51857.1| photosystem II protein M (chloroplast) [Acer griseum]
 gb|ARK38404.1| photosystem II protein M (chloroplast) [Acer buergerianum]
 gb|ARQ30031.1| photosystem II protein M (plastid) [Acer palmatum]
 gb|ASX99338.1| photosystem II protein M (chloroplast) [Aesculus wangii]
 gb|AUW55562.1| photosystem II protein M (chloroplast) [Trapa maximowiczii]
 gb|AVF91617.1| photosystem II protein M (chloroplast) [Acer truncatum]
          Length = 34

 Score = 56.6 bits (135), Expect = 1e-07
 Identities = 29/29 (100%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQSN
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQSN 34


>gb|KQK85735.1| hypothetical protein SETIT_020844mg, partial [Setaria italica]
          Length = 33

 Score = 55.8 bits (133), Expect = 2e-07
 Identities = 24/33 (72%), Positives = 27/33 (81%)
 Frame = -1

Query: 480 YGSKYSRIYSYCTLHSSSYCLFTYNLRKNGKSK 382
           YGS+YSRIY YC +HSSSYCLFTY L KN + K
Sbjct: 1   YGSQYSRIYCYCIVHSSSYCLFTYYLCKNSQPK 33


>gb|AFP87330.1| photosystem II protein M, partial (chloroplast) [Hexinia
           polydichotoma]
 gb|AFP87332.1| photosystem II protein M, partial (chloroplast) [Hexinia
           polydichotoma]
 gb|AFP87334.1| photosystem II protein M, partial (chloroplast) [Hexinia
           polydichotoma]
 gb|AFP87336.1| photosystem II protein M, partial (chloroplast) [Hexinia
           polydichotoma]
 gb|AFP87338.1| photosystem II protein M, partial (chloroplast) [Hexinia
           polydichotoma]
 gb|AFP87340.1| photosystem II protein M, partial (chloroplast) [Chondrilla
           brevirostris]
 gb|AFP87342.1| photosystem II protein M, partial (chloroplast) [Chondrilla
           ambigua]
 gb|AII21833.1| photosystem II protein M, partial (chloroplast) [Hexinia
           polydichotoma]
 gb|ASD42310.1| photosystem II protein M, partial (chloroplast) [Heteranthelium
           piliferum]
          Length = 29

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 1   LAFIATALFILVPTAFLLIIYVKTVSQNN 29


>ref|YP_398315.1| photosystem II reaction center M protein [Lactuca sativa]
 ref|YP_567070.1| photosystem II protein M (chloroplast) [Vitis vinifera]
 ref|YP_817476.1| photosystem II protein M (chloroplast) [Coffea arabica]
 ref|YP_001123193.1| PSII low MW protein [Arabis hirsuta]
 ref|YP_001123544.1| PSII low MW protein [Draba nemorosa]
 ref|YP_001123719.1| photosystem II protein M [Lobularia maritima]
 ref|YP_001718682.1| photosystem II protein M [Trachelium caeruleum]
 ref|YP_002000476.1| photosystem II protein M (chloroplast) [Brachypodium distachyon]
 ref|YP_004465174.1| photosystem II protein M [Jacobaea vulgaris]
 ref|YP_005089946.1| psbM gene product (chloroplast) [Brassica napus]
 ref|YP_007353752.1| photosystem II M protein (chloroplast) [Chrysanthemum x morifolium]
 ref|YP_007474715.1| PsbM (chloroplast) [Chrysanthemum indicum]
 ref|YP_007624781.1| photosystem II reaction center M protein (chloroplast) [Artemisia
           frigida]
 ref|YP_008963389.1| photosystem II protein M (chloroplast) [Sedum sarmentosum]
 ref|YP_009000326.1| psbM protein (chloroplast) [Arabis alpina]
 ref|YP_008999929.1| photosystem II protein M (chloroplast) [Agrostemma githago]
 ref|YP_009019785.1| photosystem II protein M (chloroplast) [Vitis rotundifolia]
 ref|YP_009046908.1| photosystem II protein M (chloroplast) [Raphanus sativus]
 ref|YP_009048569.1| photosystem II protein M [Paris verticillata]
 ref|YP_009053990.1| photosystem II reaction center M protein (chloroplast) [Hanabusaya
           asiatica]
 ref|YP_009111723.1| photosystem II reaction center M protein (chloroplast) [Artemisia
           montana]
 ref|YP_009116007.1| photosystem II reaction center M protein (chloroplast) [Campanula
           takesimana]
 ref|YP_009130036.1| photosystem II protein M (chloroplast) [Campynema lineare]
 ref|YP_009129425.1| photosystem II protein M (chloroplast) [Goodyera fumata]
 ref|YP_009135597.1| photosystem II protein M (plastid) [Zizania aquatica]
 ref|YP_009136983.1| photosystem II reaction center M protein (chloroplast) [Adenophora
           remotiflora]
 ref|YP_009142566.1| photosystem II protein M (plastid) [Trillium cuneatum]
 ref|YP_009160796.1| photosystem II protein M (chloroplast) [Haloxylon ammodendron]
 ref|YP_009160881.1| photosystem II protein M (chloroplast) [Haloxylon persicum]
 ref|YP_009163190.1| photosystem II protein M (plastid) [Trillium maculatum]
 ref|YP_009163273.1| photosystem II protein M (plastid) [Trillium tschonoskii]
 ref|YP_009166877.1| photosystem II protein M (chloroplast) [Osyris alba]
 ref|YP_009177859.1| photosystem II protein M (chloroplast) [Brassica juncea]
 ref|YP_009179724.1| PSII low MW protein (chloroplast) [Isatis tinctoria]
 ref|YP_009186603.1| photosystem II protein M (plastid) [Brighamia insignis]
 ref|YP_009192695.1| photosystem II protein M (chloroplast) [Schrenkiella parvula]
 ref|YP_009221801.1| photosystem II protein M (chloroplast) [Mesembryanthemum
           crystallinum]
 ref|YP_009229675.1| photosystem II protein M (chloroplast) [Cochlearia borzaeana]
 ref|YP_009229758.1| photosystem II protein M (chloroplast) [Cochlearia islandica]
 ref|YP_009230565.1| photosystem II protein M (chloroplast) [Cochlearia pyrenaica]
 ref|YP_009230648.1| photosystem II protein M (chloroplast) [Cochlearia tridactylites]
 ref|YP_009230731.1| photosystem II protein M (chloroplast) [Ionopsidium acaule]
 ref|YP_009231241.1| photosystem II protein M (chloroplast) [Tetrastigma hemsleyanum]
 ref|YP_009231905.1| photosystem II protein M (chloroplast) [Goodyera velutina]
 ref|YP_009233248.1| photosystem II protein M (chloroplast) [Zizania latifolia]
 ref|YP_009234976.1| photosystem II protein M (chloroplast) [Papaver somniferum]
 ref|YP_009235337.1| photosystem II protein M (chloroplast) [Vitis aestivalis]
 ref|YP_009239193.1| photosystem II protein M (chloroplast) [Pedicularis ishidoyana]
 ref|YP_009251119.1| photosystem II protein M (chloroplast) [Coffea canephora]
 ref|YP_009258960.1| photosystem II protein M (chloroplast) [Spathiphyllum kochii]
 ref|YP_009259573.1| PsbM (chloroplast) [Brassica nigra]
 ref|YP_009261690.1| photosystem II protein M (chloroplast) [Pugionium dolabratum]
 ref|YP_009261775.1| photosystem II protein M (chloroplast) [Pugionium cornutum]
 ref|YP_009271368.1| PsbM (chloroplast) [Taraxacum officinale]
 ref|YP_009271561.1| photosystem II protein M (chloroplast) [Cakile arabica]
 ref|YP_009272063.1| PsbM (chloroplast) [Artemisia argyi]
 ref|YP_009294957.1| photosystem II M protein (chloroplast) [Swertia mussotii]
 ref|YP_009306932.1| photosystem II protein M (chloroplast) [Vitis amurensis]
 ref|YP_009307465.1| PsbM (chloroplast) [Taraxacum platycarpum]
 ref|YP_009307552.1| PsbM (chloroplast) [Taraxacum mongolicum]
 ref|YP_009307738.1| PsbM (chloroplast) [Artemisia gmelinii]
 ref|YP_009307826.1| PsbM (chloroplast) [Artemisia capillaris]
 ref|YP_009316531.1| photosystem II protein M (chloroplast) [Taraxacum obtusifrons]
 ref|YP_009316616.1| photosystem II protein M (chloroplast) [Taraxacum amplum]
 ref|YP_009320266.1| photosystem II protein M (chloroplast) [Pericallis hybrida]
 ref|YP_009326107.1| photosystem II protein M (chloroplast) [Oxyria sinensis]
 ref|YP_009327472.1| photosystem II protein M (chloroplast) [Taraxacum
           brevicorniculatum]
 ref|YP_009327554.1| photosystem II protein M (chloroplast) [Taraxacum kok-saghyz]
 ref|YP_009338063.1| photosystem II reaction center M protein (plastid) [Campanula
           punctata]
 ref|YP_009339339.1| photosystem II protein M (plastid) [Cyanea fissa]
 ref|YP_009339429.1| photosystem II protein M (plastid) [Delissea rhytidosperma]
 ref|YP_009339519.1| photosystem II protein M (plastid) [Lithotoma petraea]
 ref|YP_009339598.1| photosystem II protein M (plastid) [Lobelia anceps]
 ref|YP_009339695.1| photosystem II protein M (plastid) [Lobelia boninensis]
 ref|YP_009339785.1| photosystem II protein M (plastid) [Lobelia inflata]
 ref|YP_009339874.1| photosystem II protein M (plastid) [Lobelia jasionoides]
 ref|YP_009339964.1| photosystem II protein M (plastid) [Lobelia laxiflora]
 ref|YP_009340053.1| photosystem II protein M (plastid) [Lobelia longisepala]
 ref|YP_009340141.1| photosystem II protein M (plastid) [Lobelia morogoroensis]
 ref|YP_009340230.1| photosystem II protein M (plastid) [Lobelia polyphylla]
 ref|YP_009340320.1| photosystem II protein M (plastid) [Lobelia stricklandiae]
 ref|YP_009340410.1| photosystem II protein M (plastid) [Lobelia thuliniana]
 ref|YP_009340562.1| photosystem II protein M (plastid) [Wimmerella hederacea]
 ref|YP_009343436.1| photosystem II protein M (chloroplast) [Paris mairei]
 ref|YP_009342501.1| photosystem II protein M (chloroplast) [Orychophragmus diffusus]
 ref|YP_009342586.1| photosystem II protein M (chloroplast) [Orychophragmus taibaiensis]
 ref|YP_009342671.1| photosystem II protein M (chloroplast) [Orychophragmus hupehensis]
 ref|YP_009343100.1| photosystem II protein M (chloroplast) [Paris cronquistii]
 ref|YP_009343183.1| photosystem II protein M (chloroplast) [Paris dunniana]
 ref|YP_009343266.1| photosystem II protein M (chloroplast) [Paris fargesii]
 ref|YP_009343352.1| photosystem II protein M (chloroplast) [Paris luquanensis]
 ref|YP_009343520.1| photosystem II protein M (chloroplast) [Paris marmorata]
 ref|YP_009343688.1| photosystem II protein M (chloroplast) [Paris polyphylla var.
           yunnanensis]
 ref|YP_009343772.1| photosystem II protein M (chloroplast) [Paris vietnamensis]
 ref|YP_009343858.1| photosystem II protein M (chloroplast) [Paris quadrifolia]
 ref|YP_009347699.1| photosystem II protein M (chloroplast) [Anoectochilus emeiensis]
 ref|YP_009353300.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana
           var. grandifolia]
 ref|YP_009353380.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana]
 ref|YP_009353744.1| PsbM (chloroplast) [Alyssum desertorum]
 ref|YP_009355928.1| PSII low MW protein (chloroplast) [Megadenia pygmaea]
 ref|YP_009356177.1| PSII low MW protein (chloroplast) [Megacarpaea delavayi]
 ref|YP_009365227.1| photosystem II reaction center M protein (plastid) [Artemisia
           annua]
 ref|YP_009366507.1| photosystem II protein M (plastid) [Mitragyna speciosa]
 ref|YP_009371281.1| PsbM (chloroplast) [Diplostephium pulchrum]
 ref|YP_009371366.1| PsbM (chloroplast) [Diplostephium jelskii]
 ref|YP_009371621.1| PsbM (chloroplast) [Diplostephium juniperinum]
 ref|YP_009371706.1| PsbM (chloroplast) [Diplostephium oxapampanum]
 ref|YP_009371451.1| PsbM (chloroplast) [Diplostephium lechleri]
 ref|YP_009371536.1| PsbM (chloroplast) [Lagenophora cuchumatanica]
 ref|YP_009372301.1| PsbM (chloroplast) [Diplostephium spinulosum]
 ref|YP_009372811.1| PsbM (chloroplast) [Diplostephium sagasteguii]
 ref|YP_009372980.1| PsbM (chloroplast) [Diplostephium oblanceolatum]
 ref|YP_009373065.1| PsbM (chloroplast) [Diplostephium hippophae]
 ref|YP_009373150.1| PsbM (chloroplast) [Diplostephium hartwegii]
 ref|YP_009373732.1| PsbM (chloroplast) [Diplostephium cinerascens]
 ref|YP_009374071.1| PsbM (chloroplast) [Diplostephium glandulosum]
 ref|YP_009374241.1| PsbM (chloroplast) [Diplostephium callilepis]
 ref|YP_009374326.1| PsbM (chloroplast) [Diplostephium floribundum]
 ref|YP_009374751.1| PsbM (chloroplast) [Diplostephium gynoxyoides]
 ref|YP_009375601.1| PsbM (chloroplast) [Diplostephium cajamarquillense]
 ref|YP_009376451.1| PsbM (chloroplast) [Diplostephium azureum]
 ref|YP_009376536.1| PsbM (chloroplast) [Diplostephium foliosissimum]
 ref|YP_009376791.1| PsbM (chloroplast) [Diplostephium cayambense]
 ref|YP_009376961.1| PsbM (chloroplast) [Floscaldasia hypsophila]
 ref|YP_009379607.1| PsbM (chloroplast) [Hydrangea hydrangeoides]
 ref|YP_009373986.1| PsbM (chloroplast) [Diplostephium barclayanum]
 ref|YP_009375176.1| PsbM (chloroplast) [Diplostephium gnidioides]
 ref|YP_009375431.1| PsbM (chloroplast) [Diplostephium ericoides]
 ref|YP_009375516.1| PsbM (chloroplast) [Diplostephium haenkei]
 ref|YP_009376281.1| PsbM (chloroplast) [Diplostephium espinosae]
 ref|YP_009377216.1| PsbM (chloroplast) [Diplostephium empetrifolium]
 ref|YP_009378066.1| PsbM (chloroplast) [Diplostephium goodspeedii]
 ref|YP_009379258.1| photosystem II protein M (plastid) [Champereia manillana]
 ref|YP_009379433.1| PsbM (chloroplast) [Hydrangea serrata]
 ref|YP_009379519.1| PsbM (chloroplast) [Hydrangea petiolaris]
 ref|YP_009403553.1| photosystem II protein M (plastid) [Hippobroma longiflora]
 ref|YP_009404240.1| photosystem II protein M (plastid) [Lobelia bequaertii]
 ref|YP_009404777.1| photosystem II protein M (plastid) [Lobelia kauaensis]
 ref|YP_009406030.1| photosystem II protein M (plastid) [Lobelia stuhlmannii]
 ref|YP_009406835.1| photosystem II protein M (plastid) [Trematolobelia kauaiensis]
 ref|YP_009402870.1| photosystem II protein M (plastid) [Sclerotheca longistigmata]
 ref|YP_009402959.1| photosystem II protein M (plastid) [Centropogon granulosus]
 ref|YP_009403049.1| photosystem II protein M (plastid) [Clermontia fauriei]
 ref|YP_009403139.1| photosystem II protein M (plastid) [Cyanea leptostegia]
 ref|YP_009403228.1| photosystem II protein M (plastid) [Dialypetalum floribundum]
 ref|YP_009403317.1| photosystem II protein M (plastid) [Diastatea micrantha]
 ref|YP_009403643.1| photosystem II protein M (plastid) [Hypsela tridens]
 ref|YP_009403801.1| photosystem II protein M (plastid) [Legenere valdiviana]
 ref|YP_009403970.1| photosystem II protein M (plastid) [Lobelia acrochila]
 ref|YP_009404060.1| photosystem II protein M (plastid) [Pratia angulata]
 ref|YP_009404330.1| photosystem II protein M (plastid) [Lobelia chinensis]
 ref|YP_009404420.1| photosystem II protein M (plastid) [Lobelia columnaris]
 ref|YP_009404509.1| photosystem II protein M (plastid) [Lobelia davidii]
 ref|YP_009404598.1| photosystem II protein M (plastid) [Lobelia doniana]
 ref|YP_009404688.1| photosystem II protein M (plastid) [Lobelia gibberoa]
 ref|YP_009404867.1| photosystem II protein M (plastid) [Lobelia lukwangulensis]
 ref|YP_009404957.1| photosystem II protein M (plastid) [Lobelia melliana]
 ref|YP_009405046.1| photosystem II protein M (plastid) [Lobelia mildbraedii]
 ref|YP_009405135.1| photosystem II protein M (plastid) [Lobelia muscoides]
 ref|YP_009405224.1| photosystem II protein M (plastid) [Lobelia niihauensis]
 ref|YP_009405314.1| photosystem II protein M (plastid) [Pratia nummularia]
 ref|YP_009405404.1| photosystem II protein M (plastid) [Lobelia organensis]
 ref|YP_009405494.1| photosystem II protein M (plastid) [Lobelia petiolata]
 ref|YP_009405584.1| photosystem II protein M (plastid) [Lobelia rhynchopetalum]
 ref|YP_009405673.1| photosystem II protein M (plastid) [Lobelia ritabeaniana]
 ref|YP_009405762.1| photosystem II protein M (plastid) [Lobelia sancta]
 ref|YP_009405851.1| photosystem II protein M (plastid) [Lobelia seguinii]
 ref|YP_009405940.1| photosystem II protein M (plastid) [Lobelia sessilifolia]
 ref|YP_009406120.1| photosystem II protein M (plastid) [Lobelia telekii]
 ref|YP_009406210.1| photosystem II protein M (plastid) [Lobelia thapsoidea]
 ref|YP_009406299.1| photosystem II protein M (plastid) [Lobelia udzungwensis]
 ref|YP_009406388.1| photosystem II protein M (plastid) [Lobelia urens]
 ref|YP_009406478.1| photosystem II protein M (plastid) [Lobelia wollastonii]
 ref|YP_009406567.1| photosystem II protein M (plastid) [Lobelia yuccoides]
 ref|YP_009406657.1| photosystem II protein M (plastid) [Sclerotheca viridiflora]
 ref|YP_009406746.1| photosystem II protein M (plastid) [Solenopsis bivonae]
 ref|YP_009400081.1| photosystem II protein M (chloroplast) [Sinapis arvensis]
 ref|YP_009409716.1| photosystem II protein M (chloroplast) [Morettia canescens]
 ref|YP_009409629.1| photosystem II protein M (chloroplast) [Lobularia libyca]
 ref|YP_009414729.1| photosystem II protein M (chloroplast) [Platycodon grandiflorus]
 ref|YP_009416937.1| photosystem II protein M (chloroplast) [Hydrangea luteovenosa]
 ref|YP_009422218.1| photosystem II protein M (chloroplast) [Siphocampylus krauseanus]
 ref|YP_009422305.1| photosystem II protein M (chloroplast) [Centropogon nigricans]
 ref|YP_009422392.1| photosystem II protein M (chloroplast) [Burmeistera sodiroana]
 ref|YP_009422479.1| photosystem II protein M (chloroplast) [Burmeistera smaragdi]
 ref|YP_009422566.1| photosystem II protein M (chloroplast) [Burmeistera rubrosepala]
 ref|YP_009422653.1| photosystem II protein M (chloroplast) [Burmeistera resupinata]
 ref|YP_009422740.1| photosystem II protein M (chloroplast) [Burmeistera pirrensis]
 ref|YP_009422827.1| photosystem II protein M (chloroplast) [Burmeistera parviflora]
 ref|YP_009422914.1| photosystem II protein M (chloroplast) [Burmeistera oyacachensis]
 ref|YP_009423001.1| photosystem II protein M (chloroplast) [Burmeistera lutosa]
 ref|YP_009423088.1| photosystem II protein M (chloroplast) [Burmeistera loejtnantii]
 ref|YP_009423175.1| photosystem II protein M (chloroplast) [Burmeistera fuscoapicata]
 ref|YP_009423262.1| photosystem II protein M (chloroplast) [Burmeistera domingensis]
 ref|YP_009423349.1| photosystem II protein M (chloroplast) [Burmeistera cylindrocarpa]
 ref|YP_009423436.1| photosystem II protein M (chloroplast) [Burmeistera cyclostigmata]
 ref|YP_009423523.1| photosystem II protein M (chloroplast) [Burmeistera crispiloba]
 ref|YP_009423610.1| photosystem II protein M (chloroplast) [Burmeistera ceratocarpa]
 ref|YP_009423697.1| photosystem II protein M (chloroplast) [Burmeistera borjensis]
 ref|YP_009423784.1| photosystem II protein M (chloroplast) [Burmeistera auriculata]
 ref|YP_009427896.1| photosystem II protein M (chloroplast) [Kingdonia uniflora]
 ref|YP_009433098.1| photosystem II protein M (chloroplast) [Vitis mustangensis]
 ref|YP_009428169.1| photosystem II protein M (chloroplast) [Vitis acerifolia]
 ref|YP_009434497.1| photosystem II protein M (chloroplast) [Bergenia scopulosa]
 ref|YP_009434797.1| photosystem II protein M (plastid) [Lobelia galpinii]
 ref|YP_009434879.1| photosystem II protein M (plastid) [Lobelia hartlaubii]
 ref|YP_009434966.1| photosystem II protein M (plastid) [Lobelia holstii]
 ref|YP_009435034.1| photosystem II protein M (plastid) [Lobelia laxa]
 ref|YP_009435127.1| photosystem II protein M (plastid) [Lobelia linearis]
 ref|YP_009435237.1| photosystem II protein M (plastid) [Lobelia malowensis]
 ref|YP_009435324.1| photosystem II protein M (plastid) [Lobelia patula]
 ref|YP_009435397.1| photosystem II protein M (plastid) [Lobelia puberula]
 ref|YP_009435497.1| photosystem II protein M (plastid) [Lobelia sonderiana]
 ref|YP_009435584.1| photosystem II protein M (plastid) [Lobelia spicata]
 ref|YP_009435663.1| photosystem II protein M (plastid) [Lobelia thermalis]
 ref|YP_009435746.1| photosystem II protein M (plastid) [Monopsis alba]
 ref|YP_009435835.1| photosystem II protein M (plastid) [Monopsis flava]
 ref|YP_009436048.1| photosystem II protein M (plastid) [Lobelia physaloides]
 ref|YP_009436138.1| photosystem II protein M (plastid) [Cyphia angustiloba]
 ref|YP_009436224.1| photosystem II protein M (plastid) [Cyphia banksiana]
 ref|YP_009436337.1| photosystem II protein M (plastid) [Cyphia belfastica]
 ref|YP_009436414.1| photosystem II protein M (plastid) [Cyphia crenata]
 ref|YP_009436530.1| photosystem II protein M (plastid) [Cyphia dentariifolia]
 ref|YP_009436630.1| photosystem II protein M (plastid) [Cyphia glandulifera]
 ref|YP_009436710.1| photosystem II protein M (plastid) [Cyphia phyteuma]
 ref|YP_009436825.1| photosystem II protein M (plastid) [Cyphia schlechteri]
 ref|YP_009436936.1| photosystem II protein M (plastid) [Cyphia tortilis]
 ref|YP_009437013.1| photosystem II protein M (plastid) [Grammatotheca bergiana]
 ref|YP_009437124.1| photosystem II protein M (plastid) [Lobelia baumannii]
 ref|YP_009437198.1| photosystem II protein M (plastid) [Lobelia cardinalis]
 ref|YP_009437281.1| photosystem II protein M (plastid) [Lobelia erinus]
 ref|YP_009437756.1| photosystem II protein M (chloroplast) [Vitis x champinii]
 ref|YP_009441143.1| photosystem II reaction center M protein (chloroplast) [Adenophora
           erecta]
 ref|YP_009442100.1| photosystem II protein M (chloroplast) [Emmenopterys henryi]
 ref|YP_009442499.1| photosystem II reaction center M protein (chloroplast) [Codonopsis
           minima]
 ref|YP_009442899.1| photosystem II protein M (chloroplast) [Vitis cinerea]
 ref|YP_009444209.1| photosystem II protein M (chloroplast) [Vitis coignetiae]
 ref|YP_009446066.1| photosystem II protein M (chloroplast) [Coptis chinensis]
 ref|YP_009447640.1| photosystem II protein M (chloroplast) [Vitis cordifolia]
 ref|YP_009447726.1| photosystem II protein M (chloroplast) [Vitis ficifolia]
 ref|YP_009455583.1| photosystem II protein M (chloroplast) [Vitis rupestris]
 ref|YP_009456461.1| photosystem II protein M (chloroplast) [Gymnocarpos przewalskii]
 ref|YP_009458019.1| PsbM (chloroplast) [Dendrosenecio keniodendron]
 ref|YP_009458108.1| PsbM (chloroplast) [Dendrosenecio keniensis]
 ref|YP_009458196.1| PsbM (chloroplast) [Dendrosenecio battiscombei]
 ref|YP_009458454.1| PSII low MW protein (chloroplast) [Brachypodium hybridum]
 ref|YP_009458536.1| PSII low MW protein (chloroplast) [Brachypodium stacei]
 ref|YP_009462722.1| photosystem II protein M (chloroplast) [Tetragonia tetragonioides]
 ref|YP_009468090.1| photosystem II protein M (chloroplast) [Connorochloa tenuis]
 sp|Q56P14.1|PSBM_LACSA RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M
 sp|A0A329.1|PSBM_COFAR RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M
 sp|Q0ZJ26.1|PSBM_VITVI RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M
 sp|A4QK12.1|PSBM_ARAHI RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M
 sp|A4QL13.1|PSBM_DRANE RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M
 sp|A4QLI8.1|PSBM_LOBMA RecName: Full=Photosystem II reaction center protein M;
           Short=PSII-M
 gb|AAX58141.1| PSII M protein (chloroplast) [Lactuca sativa]
 dbj|BAE47580.1| photosystem II reaction center M protein (chloroplast) [Lactuca
           sativa]
 gb|ABD47219.1| photosystem II protein M (chloroplast) [Lactuca sativa]
 gb|ABE47528.1| photosystem II protein M (chloroplast) [Vitis vinifera]
 gb|ABJ89673.1| photosystem II protein M (chloroplast) [Coffea arabica]
 dbj|BAF50017.1| PSII low MW protein (chloroplast) [Arabis hirsuta]
 dbj|BAF50368.1| PSII low MW protein (chloroplast) [Draba nemorosa]
 dbj|BAF50543.1| PSII low MW protein (chloroplast) [Lobularia maritima]
 gb|ABU85654.1| photosystem II protein M, partial (chloroplast) [Trachelium
           caeruleum]
 gb|ABV26507.1| photosystem II protein M (chloroplast) [Trachelium caeruleum]
 gb|ACF08629.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 gb|ACY66272.1| photosystem II protein M (chloroplast) [Brassica napus]
 gb|ADD30435.1| photosystem II protein M (chloroplast) [Heuchera sanguinea]
 gb|ADO15397.1| photosystem II protein M (chloroplast) [Jacobaea vulgaris]
 gb|ADW94825.1| PsbM (plastid) [Streptocarpus montigena]
 gb|ADW94827.1| PsbM (plastid) [Streptocarpus montigena]
 gb|ADW94829.1| PsbM (plastid) [Streptocarpus montigena]
 gb|ADW94831.1| PsbM (plastid) [Streptocarpus montigena]
 gb|AEX99264.1| PsbM (chloroplast) [Chrysanthemum indicum]
 gb|AEX99500.1| photosystem II M protein (chloroplast) [Chrysanthemum indicum]
 gb|AFA26834.1| photosystem II protein M (plastid) [Abolboda macrostachya]
 gb|AFA26848.1| photosystem II protein M, partial (plastid) [Flagellaria indica]
 gb|AFA45260.1| photosystem II M protein (chloroplast) [Chrysanthemum x morifolium]
 gb|AFP98807.1| photosystem II reaction center M protein (chloroplast) [Artemisia
           frigida]
 gb|AFQ99056.1| photosystem II protein M (chloroplast) [Sedum sarmentosum]
 gb|AGQ50345.1| photosystem II protein M (chloroplast) [Rumex acetosa]
 gb|AGW97095.1| photosystem II protein M (chloroplast) [Ipomoea dumetorum]
 dbj|BAO01486.1| photosystem II protein M (chloroplast) [Vitis vinifera subsp.
           caucasica]
 dbj|BAO01570.1| photosystem II protein M (chloroplast) [Vitis vinifera subsp.
           caucasica]
 dbj|BAO01654.1| photosystem II protein M (chloroplast) [Vitis vinifera subsp.
           caucasica]
 gb|AGZ13345.1| photosystem II protein M (chloroplast) [Haloxylon ammodendron]
 gb|AGZ13430.1| photosystem II protein M (chloroplast) [Haloxylon persicum]
 gb|AGZ17919.1| photosystem II protein M (chloroplast) [Agrostemma githago]
 emb|CCW28173.1| psbM protein (chloroplast) [Arabis alpina]
 gb|AHJ61131.1| photosystem II reaction center M protein (chloroplast) [Artemisia
           montana]
 gb|AHJ91203.1| photosystem II protein M (chloroplast) [Vitis rotundifolia]
 gb|AHX80445.1| photosystem II protein M (plastid) [Paris verticillata]
 gb|AHY80535.1| photosystem II protein M (plastid) [Beta vulgaris subsp. vulgaris]
 gb|AHY94446.1| photosystem II reaction center M protein (chloroplast) [Hanabusaya
           asiatica]
 gb|AHZ43052.1| photosystem II protein M (chloroplast) [Goodyera fumata]
 gb|AIE42460.1| photosystem II protein M (chloroplast) [Raphanus sativus]
 gb|AIK28998.1| photosystem II protein M (chloroplast) [Brassica napus]
 gb|AIM53772.1| photosystem II protein M (plastid) [Zizania aquatica]
 gb|AIN75577.1| photosystem II protein M (chloroplast) [Campanula americana]
 gb|AIS35677.1| photosystem II protein M (chloroplast) [Mesembryanthemum
           crystallinum]
 gb|AIZ06074.1| photosystem II protein M (chloroplast) [Brassica napus]
 gb|AIZ76886.1| photosystem II protein M (chloroplast) [Zizania latifolia]
 gb|AJB98614.1| PsbM (chloroplast) [Artemisia argyi]
 gb|AJD00854.1| photosystem II reaction center M protein (chloroplast) [Campanula
           takesimana]
 gb|AJE74527.1| photosystem II protein M (plastid) [Lactuca ludoviciana]
 gb|AJE74983.1| photosystem II protein M (plastid) [Achillea millefolium]
 gb|AJE75211.1| photosystem II protein M (plastid) [Senecio integerrimus]
 gb|AJV88505.1| photosystem II protein M (chloroplast) [Campynema lineare]
 gb|AKD00083.1| photosystem II protein M (plastid) [Brassica napus]
 gb|AKE32206.1| photosystem II reaction center M protein (chloroplast) [Adenophora
           remotiflora]
 gb|AKH59826.1| photosystem II protein M (plastid) [Trillium cuneatum]
 gb|AKJ83675.1| photosystem II protein M (chloroplast) [Spathiphyllum kochii]
 gb|AKM97912.1| PsbM (chloroplast) [Brassica oleracea var. capitata]
 gb|AKP95045.1| photosystem II protein M (chloroplast) [Anoectochilus roxburghii]
 gb|AKU36903.1| photosystem II protein M (plastid) [Trillium maculatum]
 gb|AKU36984.1| photosystem II protein M (plastid) [Trillium tschonoskii]
 gb|AKZ23259.1| photosystem II protein M (plastid) [Ellisia nyctelea]
 gb|AKZ23278.1| photosystem II protein M (plastid) [Impatiens capensis]
 gb|AKZ23279.1| photosystem II protein M (plastid) [Comandra umbellata]
 gb|AKZ23283.1| photosystem II protein M (plastid) [Campanula rotundifolia]
 gb|ALB78414.1| photosystem II protein M (chloroplast) [Heuchera parviflora var.
           saurensis]
 gb|ALC75177.1| photosystem II protein M (chloroplast) [Osyris alba]
 gb|ALE65914.1| photosystem II protein M (chloroplast) [Pericallis hybrida]
 gb|ALG63283.1| photosystem II protein M (chloroplast) [Beta vulgaris subsp.
           vulgaris]
 gb|ALI30850.1| photosystem II protein M (plastid) [Brighamia insignis]
 gb|ALK26677.1| photosystem II protein M (chloroplast) [Brassica juncea]
 gb|ALL45464.1| PSII low MW protein (chloroplast) [Isatis tinctoria]
 gb|ALO71256.1| photosystem II protein M (chloroplast) [Ampelopsis glandulosa var.
           brevipedunculata]
 gb|ALP73112.1| photosystem II protein M (chloroplast) [Schrenkiella parvula]
 emb|CRN13133.1| photosystem II protein M (chloroplast) [Cochlearia borzaeana]
 emb|CRN13216.1| photosystem II protein M (chloroplast) [Cochlearia islandica]
 emb|CRN13299.1| photosystem II protein M (chloroplast) [Cochlearia pyrenaica]
 emb|CRN13382.1| photosystem II protein M (chloroplast) [Cochlearia tridactylites]
 emb|CRN13465.1| photosystem II protein M (chloroplast) [Ionopsidium acaule]
 gb|ALV89919.1| photosystem II protein M (chloroplast) [Tetrastigma hemsleyanum]
 gb|AMA07283.1| photosystem II protein M (chloroplast) [Goodyera velutina]
 gb|AMB27128.1| photosystem II protein M (chloroplast) [Zizania latifolia]
 gb|AMD08694.1| photosystem II protein M (chloroplast) [Papaver somniferum]
 gb|AMD12011.1| photosystem II protein M (chloroplast) [Vitis aestivalis]
 gb|AML80398.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 gb|AML80544.1| photosystem II protein M (chloroplast) [Pedicularis ishidoyana]
 gb|AMR74021.1| photosystem II reaction center M protein (plastid) [Campanula
           punctata]
 gb|AMX21810.1| psbM (mitochondrion) [Dendrosenecio brassiciformis]
 gb|ANA07410.1| photosystem II protein M (chloroplast) [Coffea canephora]
 gb|AND76554.1| photosystem II protein M (chloroplast) [Paris polyphylla var.
           yunnanensis]
 gb|ANE10904.1| PsbM (chloroplast) [Brassica nigra]
 gb|ANJ04036.1| photosystem II protein M (chloroplast) [Pugionium dolabratum]
 gb|ANJ04121.1| photosystem II protein M (chloroplast) [Pugionium cornutum]
 gb|ANK36704.1| photosystem II protein M (chloroplast) [Sinapis arvensis]
 gb|ANN38926.1| PsbM (chloroplast) [Hydrangea serrata f. fertilis]
 gb|ANO44591.1| photosystem II protein M (chloroplast) [Amianthium muscitoxicum]
 gb|ANO44713.1| photosystem II protein M (chloroplast) [Calochortus albus]
 gb|ANO45128.1| photosystem II protein M (chloroplast) [Campynemanthe viridiflora]
 gb|ANO45422.1| photosystem II protein M (chloroplast) [Trillium luteum]
 gb|ANS11243.1| PsbM (chloroplast) [Artemisia fukudo]
 gb|ANS57980.1| PsbM (chloroplast) [Ligularia fischeri]
 gb|ANT45662.1| photosystem II protein M (chloroplast) [Isatis tinctoria]
 gb|ANW47862.1| PsbM (chloroplast) [Taraxacum officinale]
 gb|ANW83271.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83358.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83444.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83529.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83615.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83703.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83789.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83875.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANW83961.1| PsbM (plastid) [Brassica napus var. napus]
 gb|ANX10040.1| photosystem II protein M (chloroplast) [Cakile arabica]
 gb|ANX10295.1| photosystem II protein M (chloroplast) [Striga hermonthica]
 gb|AOG66067.1| photosystem II M protein (chloroplast) [Swertia mussotii]
 gb|AOP04292.1| photosystem II protein M (chloroplast) [Gentiana lawrencei var.
           farreri]
 gb|AOR52764.1| photosystem II protein M (chloroplast) [Vitis amurensis]
 gb|AOR82212.1| PsbM (chloroplast) [Taraxacum platycarpum]
 gb|AOR82299.1| PsbM (chloroplast) [Taraxacum mongolicum]
 gb|AOR82572.1| PsbM (chloroplast) [Artemisia gmelinii]
 gb|AOR82660.1| PsbM (chloroplast) [Artemisia capillaris]
 gb|AOV63658.1| photosystem II protein M (chloroplast) [Clermontia samuelii subsp.
           hanaensis]
 gb|AOV93787.1| photosystem II protein M (chloroplast) [Taraxacum sp. RHS-2016]
 gb|AOV93872.1| photosystem II protein M (chloroplast) [Taraxacum obtusifrons]
 gb|AOV93956.1| photosystem II protein M (chloroplast) [Taraxacum amplum]
 gb|APA33598.1| photosystem II protein M (chloroplast) [Taraxacum
           brevicorniculatum]
 gb|APA33680.1| photosystem II protein M (chloroplast) [Taraxacum kok-saghyz]
 gb|APA33762.1| photosystem II protein M (chloroplast) [Taraxacum officinale]
 gb|APD26336.1| photosystem II protein M (chloroplast) [Oxyria sinensis]
 gb|APM86084.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana
           var. grandifolia]
 gb|APM86164.1| photosystem II protein M (chloroplast) [Sinalliaria limprichtiana]
 gb|APO08520.1| photosystem II protein M (chloroplast) [Orychophragmus violaceus]
 gb|APO09252.1| PSII low MW protein (chloroplast) [Megadenia pygmaea]
 gb|APQ38732.1| photosystem II protein M (plastid) [Cyanea fissa]
 gb|APQ38822.1| photosystem II protein M (plastid) [Delissea rhytidosperma]
 gb|APQ38912.1| photosystem II protein M (plastid) [Lithotoma petraea]
 gb|APQ38991.1| photosystem II protein M (plastid) [Lobelia anceps]
 gb|APQ39088.1| photosystem II protein M (plastid) [Lobelia boninensis]
 gb|APQ39178.1| photosystem II protein M (plastid) [Lobelia gregoriana subsp.
           sattimae]
 gb|APQ39268.1| photosystem II protein M (plastid) [Lobelia inflata]
 gb|APQ39357.1| photosystem II protein M (plastid) [Lobelia jasionoides]
 gb|APQ39447.1| photosystem II protein M (plastid) [Lobelia laxiflora]
 gb|APQ39536.1| photosystem II protein M (plastid) [Lobelia longisepala]
 gb|APQ39624.1| photosystem II protein M (plastid) [Lobelia morogoroensis]
 gb|APQ39713.1| photosystem II protein M (plastid) [Lobelia polyphylla]
 gb|APQ39803.1| photosystem II protein M (plastid) [Lobelia siphilitica var.
           siphilitica]
 gb|APQ39893.1| photosystem II protein M (plastid) [Lobelia stricklandiae]
 gb|APQ39983.1| photosystem II protein M (plastid) [Lobelia thuliniana]
 gb|APQ40135.1| photosystem II protein M (plastid) [Wimmerella hederacea]
 gb|APS85075.1| photosystem II protein M (chloroplast) [Orychophragmus sp.
           HH-2017b]
 gb|APS85160.1| photosystem II protein M (chloroplast) [Orychophragmus diffusus]
 gb|APS85245.1| photosystem II protein M (chloroplast) [Orychophragmus sp.
           HH-2017a]
 gb|APS85330.1| photosystem II protein M (chloroplast) [Orychophragmus taibaiensis]
 gb|APS85415.1| photosystem II protein M (chloroplast) [Orychophragmus hupehensis]
 gb|APS87339.1| photosystem II protein M (chloroplast) [Paris cronquistii]
 gb|APS87423.1| photosystem II protein M (chloroplast) [Paris dunniana]
 gb|APS87505.1| photosystem II protein M (chloroplast) [Paris fargesii]
 gb|APS87591.1| photosystem II protein M (chloroplast) [Paris fargesii]
 gb|APS87675.1| photosystem II protein M (chloroplast) [Paris luquanensis]
 gb|APS87759.1| photosystem II protein M (chloroplast) [Paris mairei]
 gb|APS87843.1| photosystem II protein M (chloroplast) [Paris marmorata]
 gb|APS88011.1| photosystem II protein M (chloroplast) [Paris polyphylla var.
           yunnanensis]
 gb|APS88095.1| photosystem II protein M (chloroplast) [Paris vietnamensis]
 gb|APS88181.1| photosystem II protein M (chloroplast) [Paris quadrifolia]
 dbj|BAW81307.1| photosystem II protein M (chloroplast) [Anoectochilus emeiensis]
 gb|AQS80559.1| photosystem II protein M (chloroplast) [Siphocampylus krauseanus]
 gb|AQS80646.1| photosystem II protein M (chloroplast) [Centropogon nigricans]
 gb|AQS80733.1| photosystem II protein M (chloroplast) [Burmeistera sodiroana]
 gb|AQS80820.1| photosystem II protein M (chloroplast) [Burmeistera smaragdi]
 gb|AQS80907.1| photosystem II protein M (chloroplast) [Burmeistera rubrosepala]
 gb|AQS80994.1| photosystem II protein M (chloroplast) [Burmeistera resupinata]
 gb|AQS81081.1| photosystem II protein M (chloroplast) [Burmeistera pirrensis]
 gb|AQS81168.1| photosystem II protein M (chloroplast) [Burmeistera parviflora]
 gb|AQS81255.1| photosystem II protein M (chloroplast) [Burmeistera oyacachensis]
 gb|AQS81342.1| photosystem II protein M (chloroplast) [Burmeistera lutosa]
 gb|AQS81429.1| photosystem II protein M (chloroplast) [Burmeistera loejtnantii]
 gb|AQS81516.1| photosystem II protein M (chloroplast) [Burmeistera fuscoapicata]
 gb|AQS81603.1| photosystem II protein M (chloroplast) [Burmeistera domingensis]
 gb|AQS81690.1| photosystem II protein M (chloroplast) [Burmeistera cylindrocarpa]
 gb|AQS81776.1| photosystem II protein M (chloroplast) [Burmeistera cyclostigmata]
 gb|AQS81864.1| photosystem II protein M (chloroplast) [Burmeistera crispiloba]
 gb|AQS81951.1| photosystem II protein M (chloroplast) [Burmeistera ceratocarpa]
 gb|AQS82038.1| photosystem II protein M (chloroplast) [Burmeistera borjensis]
 gb|AQS82125.1| photosystem II protein M (chloroplast) [Burmeistera auriculata]
 gb|AQV10256.1| PSII low MW protein (chloroplast) [Megacarpaea delavayi]
 gb|AQZ25185.1| PsbM (chloroplast) [Alyssum desertorum]
 gb|ARH02937.1| PsbM (chloroplast) [Diplostephium pulchrum]
 gb|ARH03022.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARH03192.1| PsbM (chloroplast) [Diplostephium jelskii]
 gb|ARH03362.1| PsbM (chloroplast) [Diplostephium cinerascens]
 gb|ARH03616.1| PsbM (chloroplast) [Diplostephium barclayanum]
 gb|ARH03701.1| PsbM (chloroplast) [Diplostephium glandulosum]
 gb|ARH03786.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARH03871.1| PsbM (chloroplast) [Diplostephium lechleri]
 gb|ARH04041.1| PsbM (chloroplast) [Diplostephium callilepis]
 gb|ARH04211.1| PsbM (chloroplast) [Diplostephium floribundum]
 gb|ARH04636.1| PsbM (chloroplast) [Diplostephium gynoxyoides]
 gb|ARH04806.1| PsbM (chloroplast) [Lagenophora cuchumatanica]
 gb|ARH04891.1| PsbM (chloroplast) [Diplostephium hartwegii]
 gb|ARH05146.1| PsbM (chloroplast) [Diplostephium juniperinum]
 gb|ARH05231.1| PsbM (chloroplast) [Diplostephium oxapampanum]
 gb|ARH05486.1| PsbM (chloroplast) [Diplostephium gnidioides]
 gb|ARH05911.1| PsbM (chloroplast) [Diplostephium ericoides]
 gb|ARH05996.1| PsbM (chloroplast) [Diplostephium haenkei]
 gb|ARH06081.1| PsbM (chloroplast) [Diplostephium cajamarquillense]
 gb|ARH06761.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARH06846.1| PsbM (chloroplast) [Diplostephium espinosae]
 gb|ARH06931.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARH07186.1| PsbM (chloroplast) [Diplostephium azureum]
 gb|ARH07356.1| PsbM (chloroplast) [Diplostephium foliosissimum]
 gb|ARH07611.1| PsbM (chloroplast) [Diplostephium cayambense]
 gb|ARH07951.1| PsbM (chloroplast) [Floscaldasia hypsophila]
 gb|ARH08036.1| PsbM (chloroplast) [Diplostephium spinulosum]
 gb|ARH08121.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARH08716.1| PsbM (chloroplast) [Diplostephium empetrifolium]
 gb|ARH09311.1| PsbM (chloroplast) [Diplostephium sagasteguii]
 gb|ARH09820.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARH09990.1| PsbM (chloroplast) [Diplostephium goodspeedii]
 gb|ARH10075.1| PsbM (chloroplast) [Diplostephium oblanceolatum]
 gb|ARH10160.1| PsbM (chloroplast) [Diplostephium pulchrum]
 gb|ARH10330.1| PsbM (chloroplast) [Diplostephium hippophae]
 gb|ARH10500.1| PsbM (chloroplast) [Diplostephium sp. CAJ2]
 gb|ARI46728.1| photosystem II protein M (chloroplast) [Arabis stelleri subsp.
           japonica]
 gb|ARJ60822.1| photosystem II reaction center M protein (plastid) [Artemisia
           annua]
 gb|ARJ62347.1| photosystem II protein M (plastid) [Mitragyna speciosa]
 gb|ARJ62432.1| photosystem II protein M (plastid) [Coffea arabica]
 gb|ARO35120.1| photosystem II reaction center M protein (chloroplast) [Adenophora
           erecta]
 gb|ARQ29957.1| photosystem II protein M (plastid) [Champereia manillana]
 gb|ARQ81408.1| PsbM (chloroplast) [Hydrangea serrata]
 gb|ARQ81494.1| PsbM (chloroplast) [Hydrangea serrata]
 gb|ARQ81580.1| PsbM (chloroplast) [Hydrangea serrata]
 gb|ARQ81666.1| PsbM (chloroplast) [Hydrangea serrata]
 gb|ARQ81752.1| PsbM (chloroplast) [Hydrangea petiolaris]
 gb|ARQ81840.1| PsbM (chloroplast) [Hydrangea hydrangeoides]
 gb|ARQ81928.1| PsbM (chloroplast) [Hydrangea serrata]
 gb|ARR27734.1| photosystem II protein M (chloroplast) [Platycodon grandiflorus]
 gb|ARU07796.1| PsbM (chloroplast) [Artemisia gmelinii]
 gb|ARU07884.1| PsbM (chloroplast) [Artemisia capillaris]
 dbj|BAX84085.1| photosystem II protein M (chloroplast) [Goodyera schlechtendaliana]
 dbj|BAX87996.1| photosystem II protein M (chloroplast) [Goodyera schlechtendaliana]
 gb|ARX96520.1| photosystem II protein M (chloroplast) [Coptis chinensis]
 gb|ASA34063.1| photosystem II protein M (plastid) [Sclerotheca longistigmata]
 gb|ASA34152.1| photosystem II protein M (plastid) [Centropogon granulosus]
 gb|ASA34242.1| photosystem II protein M (plastid) [Clermontia fauriei]
 gb|ASA34332.1| photosystem II protein M (plastid) [Cyanea leptostegia]
 gb|ASA34421.1| photosystem II protein M (plastid) [Dialypetalum floribundum]
 gb|ASA34510.1| photosystem II protein M (plastid) [Diastatea micrantha]
 gb|ASA34746.1| photosystem II protein M (plastid) [Hippobroma longiflora]
 gb|ASA34836.1| photosystem II protein M (plastid) [Hypsela tridens]
 gb|ASA35067.1| photosystem II protein M (plastid) [Legenere valdiviana]
 gb|ASA35236.1| photosystem II protein M (plastid) [Lobelia acrochila]
 gb|ASA35326.1| photosystem II protein M (plastid) [Pratia angulata]
 gb|ASA35506.1| photosystem II protein M (plastid) [Lobelia bequaertii]
 gb|ASA35595.1| photosystem II protein M (plastid) [Lobelia burttii subsp. burttii]
 gb|ASA35685.1| photosystem II protein M (plastid) [Lobelia burttii subsp.
           meruensis]
 gb|ASA35775.1| photosystem II protein M (plastid) [Lobelia burttii subsp.
           telmaticola]
 gb|ASA35865.1| photosystem II protein M (plastid) [Lobelia chinensis]
 gb|ASA35955.1| photosystem II protein M (plastid) [Lobelia columnaris]
 gb|ASA36045.1| photosystem II protein M (plastid) [Lobelia columnaris]
 gb|ASA36134.1| photosystem II protein M (plastid) [Lobelia davidii]
 gb|ASA36224.1| photosystem II protein M (plastid) [Lobelia deckenii subsp.
           deckenii]
 gb|ASA36314.1| photosystem II protein M (plastid) [Lobelia deckenii subsp.
           incipiens]
 gb|ASA36403.1| photosystem II protein M (plastid) [Lobelia doniana]
 gb|ASA36493.1| photosystem II protein M (plastid) [Lobelia gibberoa]
 gb|ASA36583.1| photosystem II protein M (plastid) [Lobelia gregoriana subsp.
           elgonensis]
 gb|ASA36673.1| photosystem II protein M (plastid) [Lobelia gregoriana subsp.
           gregoriana]
 gb|ASA36762.1| photosystem II protein M (plastid) [Lobelia kauaensis]
 gb|ASA36852.1| photosystem II protein M (plastid) [Lobelia lukwangulensis]
 gb|ASA36942.1| photosystem II protein M (plastid) [Lobelia melliana]
 gb|ASA37031.1| photosystem II protein M (plastid) [Lobelia mildbraedii]
 gb|ASA37121.1| photosystem II protein M (plastid) [Lobelia montana]
 gb|ASA37210.1| photosystem II protein M (plastid) [Lobelia muscoides]
 gb|ASA37299.1| photosystem II protein M (plastid) [Lobelia niihauensis]
 gb|ASA37389.1| photosystem II protein M (plastid) [Pratia nummularia]
 gb|ASA37479.1| photosystem II protein M (plastid) [Lobelia organensis]
 gb|ASA37569.1| photosystem II protein M (plastid) [Lobelia petiolata]
 gb|ASA37659.1| photosystem II protein M (plastid) [Lobelia rhynchopetalum]
 gb|ASA37748.1| photosystem II protein M (plastid) [Lobelia ritabeaniana]
 gb|ASA37837.1| photosystem II protein M (plastid) [Lobelia sancta]
 gb|ASA37926.1| photosystem II protein M (plastid) [Lobelia seguinii]
 gb|ASA38015.1| photosystem II protein M (plastid) [Lobelia sessilifolia]
 gb|ASA38194.1| photosystem II protein M (plastid) [Lobelia sp. 2 EBK-2017]
 gb|ASA38284.1| photosystem II protein M (plastid) [Lobelia sp. 3 EBK-2017]
 gb|ASA38372.1| photosystem II protein M (plastid) [Lobelia sp. RBGK8504378]
 gb|ASA38462.1| photosystem II protein M (plastid) [Lobelia stuhlmannii]
 gb|ASA38552.1| photosystem II protein M (plastid) [Lobelia telekii]
 gb|ASA38642.1| photosystem II protein M (plastid) [Lobelia thapsoidea]
 gb|ASA38731.1| photosystem II protein M (plastid) [Lobelia udzungwensis]
 gb|ASA38820.1| photosystem II protein M (plastid) [Lobelia urens]
 gb|ASA38910.1| photosystem II protein M (plastid) [Lobelia wollastonii]
 gb|ASA38999.1| photosystem II protein M (plastid) [Lobelia yuccoides]
 gb|ASA39088.1| photosystem II protein M (plastid) [Palmerella debilis subsp.
           serrata]
 gb|ASA39178.1| photosystem II protein M (plastid) [Sclerotheca viridiflora]
 gb|ASA39267.1| photosystem II protein M (plastid) [Solenopsis bivonae]
 gb|ASA39356.1| photosystem II protein M (plastid) [Trematolobelia kauaiensis]
 gb|ASD40852.1| photosystem II protein M (chloroplast) [Dasypyrum villosum]
 gb|ASD40931.1| photosystem II protein M (chloroplast) [Dasypyrum villosum]
 gb|ASD41009.1| photosystem II protein M (chloroplast) [Dasypyrum villosum]
 gb|ASD42390.1| photosystem II protein M (chloroplast) [Heteranthelium piliferum]
 gb|ASD43396.1| photosystem II protein M (chloroplast) [Elymus cognatus]
 gb|ASD43474.1| photosystem II protein M (chloroplast) [Pseudoroegneria spicata]
 gb|ASD43548.1| photosystem II protein M (chloroplast) [Pseudoroegneria spicata]
 gb|ASD43698.1| photosystem II protein M (chloroplast) [Elymus stipifolius]
 gb|ASD43984.1| photosystem II protein M (chloroplast) [Pseudoroegneria strigosa]
 gb|ASD44142.1| photosystem II protein M (chloroplast) [Pseudoroegneria strigosa]
 gb|ASD44294.1| photosystem II protein M (chloroplast) [Elymus tauri]
 gb|ASD44441.1| photosystem II protein M (chloroplast) [Elymus tauri]
 gb|ASD45529.1| photosystem II protein M (chloroplast) [Thinopyrum bessarabicum]
 gb|ASD45607.1| photosystem II protein M (chloroplast) [Thinopyrum distichum]
 gb|ASD45758.1| photosystem II protein M (chloroplast) [Thinopyrum elongatum]
 gb|ASI13283.1| photosystem II protein M (chloroplast) [Brachypodium pinnatum]
 gb|ASJ64035.1| photosystem II protein M (chloroplast) [Anastatica hierochuntica]
 gb|ASJ64207.1| photosystem II protein M (chloroplast) [Dontostemon micranthus]
 gb|ASJ64376.1| photosystem II protein M (chloroplast) [Farsetia stylosa]
 gb|ASJ64711.1| photosystem II protein M (chloroplast) [Lobularia libyca]
 gb|ASJ64882.1| photosystem II protein M (chloroplast) [Morettia canescens]
 gb|ASM41920.1| photosystem II protein M (chloroplast) [Alyssum montanum subsp.
           gmelinii]
 gb|AST10068.1| photosystem II protein M (chloroplast) [Hydrangea luteovenosa]
 gb|ASU96406.1| photosystem II protein M (chloroplast) [Lasthenia californica]
 gb|ASV47772.1| photosystem II protein M (chloroplast) [Kingdonia uniflora]
 dbj|BBA26342.1| photosystem II protein M (chloroplast) [Vitis acerifolia]
 dbj|BBA27149.1| photosystem II protein M (chloroplast) [Vitis aestivalis]
 dbj|BBA31531.1| photosystem II protein M (chloroplast) [Vitis amurensis]
 gb|ASY93356.1| PsbM (chloroplast) [Brassica rapa]
 gb|ASY93443.1| PsbM (chloroplast) [Brassica rapa subsp. chinensis]
 gb|ASY93530.1| PsbM (chloroplast) [Brassica rapa subsp. pekinensis]
 gb|ASY93617.1| PsbM (chloroplast) [Brassica rapa subsp. rapa]
 gb|ASY93704.1| PsbM (chloroplast) [Brassica nigra]
 gb|ASY93791.1| PsbM (chloroplast) [Brassica nigra]
 gb|ASY93878.1| PsbM (chloroplast) [Brassica nigra]
 gb|ASY93965.1| PsbM (chloroplast) [Brassica oleracea var. capitata]
 gb|ASY94052.1| PsbM (chloroplast) [Brassica oleracea var. botrytis]
 gb|ASY94139.1| PsbM (chloroplast) [Brassica oleracea var. gongylodes]
 gb|ASY94226.1| PsbM (chloroplast) [Brassica oleracea var. italica]
 gb|ASY94313.1| PsbM (chloroplast) [Raphanus raphanistrum subsp. landra]
 gb|ASY94400.1| PsbM (chloroplast) [Raphanus sativus var. raphanistroides]
 gb|ASY94487.1| PsbM (chloroplast) [Raphanus sativus var. sativus]
 gb|ASY94574.1| PsbM (chloroplast) [Raphanus sativus var. sativus]
 gb|ASY94661.1| PsbM (chloroplast) [Brassica juncea subsp. integrifolia]
 gb|ASY94748.1| PsbM (chloroplast) [Brassica juncea subsp. integrifolia]
 gb|ASY94835.1| PsbM (chloroplast) [Brassica juncea]
 gb|ASY94922.1| PsbM (chloroplast) [Brassica juncea subsp. integrifolia]
 gb|ASY95009.1| PsbM (chloroplast) [Brassica napus]
 gb|ASY95096.1| PsbM (chloroplast) [Brassica napus var. napus]
 gb|ASY95183.1| PsbM (chloroplast) [Brassica napus var. napus]
 gb|ASY95270.1| PsbM (chloroplast) [Brassica napus var. napus]
 gb|ASY95357.1| PsbM (chloroplast) [Brassica carinata]
 gb|ASY95444.1| PsbM (chloroplast) [Brassica carinata]
 gb|ASY95531.1| PsbM (chloroplast) [Brassica carinata]
 gb|ASY95618.1| PsbM (chloroplast) [Brassica carinata]
 dbj|BBA46190.1| photosystem II protein M (chloroplast) [Vitis cinerea var. helleri]
 dbj|BBA53914.1| photosystem II protein M (chloroplast) [Vitis mustangensis]
 gb|ATE89545.1| photosystem II protein M (chloroplast) [Bergenia scopulosa]
 gb|ATG24584.1| photosystem II protein M (plastid) [Lobelia fervens subsp. fervens]
 gb|ATG24704.1| photosystem II protein M (plastid) [Lobelia galpinii]
 gb|ATG24787.1| photosystem II protein M (plastid) [Lobelia hartlaubii]
 gb|ATG24881.1| photosystem II protein M (plastid) [Lobelia heterophylla subsp.
           heterophylla]
 gb|ATG24968.1| photosystem II protein M (plastid) [Lobelia holstii]
 gb|ATG25036.1| photosystem II protein M (plastid) [Lobelia laxa]
 gb|ATG25129.1| photosystem II protein M (plastid) [Lobelia linearis]
 gb|ATG25239.1| photosystem II protein M (plastid) [Lobelia malowensis]
 gb|ATG25326.1| photosystem II protein M (plastid) [Lobelia patula]
 gb|ATG25399.1| photosystem II protein M (plastid) [Lobelia puberula]
 gb|ATG25499.1| photosystem II protein M (plastid) [Lobelia sonderiana]
 gb|ATG25585.1| photosystem II protein M (plastid) [Lobelia spicata]
 gb|ATG25665.1| photosystem II protein M (plastid) [Lobelia thermalis]
 gb|ATG25748.1| photosystem II protein M (plastid) [Monopsis alba]
 gb|ATG25838.1| photosystem II protein M (plastid) [Monopsis debilis var. debilis]
 gb|ATG25926.1| photosystem II protein M (plastid) [Monopsis flava]
 gb|ATG26052.1| photosystem II protein M (plastid) [Monopsis stellarioides subsp.
           schimperiana]
 gb|ATG26225.1| photosystem II protein M (plastid) [Lobelia physaloides]
 gb|ATG26315.1| photosystem II protein M (plastid) [Cyphia angustiloba]
 gb|ATG26402.1| photosystem II protein M (plastid) [Cyphia banksiana]
 gb|ATG26514.1| photosystem II protein M (plastid) [Cyphia belfastica]
 gb|ATG26608.1| photosystem II protein M (plastid) [Cyphia bulbosa var. bulbosa]
 gb|ATG26690.1| photosystem II protein M (plastid) [Cyphia crenata]
 gb|ATG26805.1| photosystem II protein M (plastid) [Cyphia dentariifolia]
 gb|ATG26886.1| photosystem II protein M (plastid) [Cyphia elata var. gerrardii]
 gb|ATG27005.1| photosystem II protein M (plastid) [Cyphia glandulifera]
 gb|ATG27086.1| photosystem II protein M (plastid) [Cyphia phyteuma]
 gb|ATG27200.1| photosystem II protein M (plastid) [Cyphia schlechteri]
 gb|ATG27311.1| photosystem II protein M (plastid) [Cyphia tortilis]
 gb|ATG27389.1| photosystem II protein M (plastid) [Grammatotheca bergiana]
 gb|ATG27501.1| photosystem II protein M (plastid) [Lobelia baumannii]
 gb|ATG27574.1| photosystem II protein M (plastid) [Lobelia cardinalis]
 gb|ATG27657.1| photosystem II protein M (plastid) [Lobelia erinus]
 dbj|BBA54783.1| photosystem II protein M (chloroplast) [Vitis x champinii]
 gb|ATL16558.1| photosystem II protein M (chloroplast) [Artemisia princeps]
 gb|ATL16620.1| photosystem II protein M (chloroplast) [Artemisia argyrophylla]
 gb|ATL16682.1| photosystem II protein M (chloroplast) [Artemisia montana]
 gb|ATL16879.1| photosystem II protein M (chloroplast) [Chrysanthemum zawadskii
           var. latilobum]
 gb|ATL16942.1| photosystem II protein M (chloroplast) [Chrysanthemum zawadskii
           subsp. coreanum]
 gb|ATL57824.1| PsbM (chloroplast) [Dendrosenecio keniodendron]
 gb|ATL57913.1| PsbM (chloroplast) [Dendrosenecio keniensis]
 gb|ATL58002.1| PsbM (chloroplast) [Dendrosenecio battiscombei]
 gb|ATN40366.1| photosystem II protein M (chloroplast) [Emmenopterys henryi]
 gb|ATO90178.1| photosystem II reaction center M protein (chloroplast) [Codonopsis
           minima]
 dbj|BBB03553.1| photosystem II protein M (chloroplast) [Vitis cinerea]
 dbj|BBB04572.1| photosystem II protein M (chloroplast) [Vitis coignetiae]
 gb|ATU84311.1| photosystem II protein M (chloroplast) [Artemisia annua]
 dbj|BBB35970.1| photosystem II protein M (chloroplast) [Vitis cordifolia]
 dbj|BBB38400.1| photosystem II protein M (chloroplast) [Vitis ficifolia]
 gb|AUF33349.1| PsbM (chloroplast) [Hydrangea aspera]
 gb|AUF33519.1| PsbM (chloroplast) [Hydrangea heteromalla]
 dbj|BBB55956.1| photosystem II protein M (chloroplast) [Vitis flexuosa]
 dbj|BBB94360.1| psbM (chloroplast) [Vitis monticola]
 dbj|BBC14949.1| photosystem II protein M (chloroplast) [Vitis rupestris]
 gb|AUJ23051.1| photosystem II protein M (chloroplast) [Gymnocarpos przewalskii]
 emb|CZT22472.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|CZT22555.1| PSII low MW protein (chloroplast) [Brachypodium hybridum]
 emb|SAP09118.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09198.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09280.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09364.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09448.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09532.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09616.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09699.1| PSII low MW protein (chloroplast) [Brachypodium stacei]
 emb|SAP09783.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09867.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP09951.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10034.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10118.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10202.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10285.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10369.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10453.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10537.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10621.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10705.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10789.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10872.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP10956.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11039.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11121.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11204.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11288.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11371.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11455.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11539.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11623.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11705.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11788.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11872.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP11956.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12040.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12124.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12208.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12291.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12374.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12457.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12540.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12622.1| PSII low MW protein (chloroplast) [Brachypodium hybridum]
 emb|SAP12706.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12790.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12874.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP12958.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13042.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13126.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13210.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13291.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13375.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13459.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13543.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 emb|SAP13627.1| PSII low MW protein (chloroplast) [Brachypodium distachyon]
 gb|AUT83215.1| photosystem II reaction center M protein (plastid) [Campanula
           rapunculoides]
 gb|AUT83276.1| photosystem II reaction center M protein (plastid) [Campanula
           rotundifolia]
 gb|AUV65203.1| photosystem II protein M (chloroplast) [Tetragonia tetragonioides]
 gb|AVA08367.1| photosystem II protein M (chloroplast) [Connorochloa tenuis]
 gb|AVI25895.1| photosystem II M protein (chloroplast) [Chrysanthemum boreale]
 gb|AVI69777.1| PsbM (chloroplast) [Hydrocera triflora]
 gb|AVI69866.1| PsbM (chloroplast) [Impatiens piufanensis]
 gb|AVK39692.1| photosystem II protein M (chloroplast) [Hancornia speciosa]
 dbj|BBC42832.1| photosystem II protein M (chloroplast) [Arabis hirsuta var.
           nipponica]
 dbj|BBC42918.1| photosystem II protein M (chloroplast) [Arabis hirsuta]
 dbj|BBC43004.1| photosystem II protein M (chloroplast) [Arabis flagellosa]
          Length = 34

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>ref|YP_009262745.1| photosystem II protein M (chloroplast) [Ludisia discolor]
 gb|ANI87410.1| photosystem II protein M (chloroplast) [Ludisia discolor]
          Length = 34

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>ref|YP_009403732.1| photosystem II protein M (plastid) [Isotoma hypocrateriformis]
 gb|AMC31899.1| photosystem II protein M (chloroplast) [Viola pedatifida]
 gb|ASA34925.1| photosystem II protein M (plastid) [Isotoma hypocrateriformis]
 gb|ASA34998.1| photosystem II protein M (plastid) [Isotoma hypocrateriformis]
 gb|ASA38105.1| photosystem II protein M (plastid) [Lobelia sp. 1 EBK-2017]
          Length = 34

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQTN 34


>ref|YP_008758182.1| photosystem II protein M (chloroplast) [Veratrum patulum]
 gb|AGX28837.1| photosystem II protein M (chloroplast) [Veratrum patulum]
          Length = 34

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>ref|YP_009373817.1| PsbM (chloroplast) [Soliva sessilis]
 gb|ARH03447.1| PsbM (chloroplast) [Soliva sessilis]
          Length = 35

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>gb|AKF01761.1| photosystem II protein M (chloroplast) [Iriartea deltoidea]
          Length = 35

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 7   LAFIATALFILVPTAFLLIIYVKTVSQNN 35


>ref|YP_009404150.1| photosystem II protein M (plastid) [Lobelia bambuseti]
 gb|ASA35416.1| photosystem II protein M (plastid) [Lobelia bambuseti]
          Length = 37

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>ref|YP_009403880.1| photosystem II protein M (plastid) [Lobelia aberdarica]
 gb|ASA35146.1| photosystem II protein M (plastid) [Lobelia aberdarica]
          Length = 37

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>ref|YP_009145255.1| photosystem II protein M (plastid) [Trillium decumbens]
 gb|AKK32133.1| photosystem II protein M (plastid) [Trillium decumbens]
          Length = 37

 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 28/29 (96%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQNN 34


>ref|YP_009427812.1| photosystem II protein M (chloroplast) [Circaeaster agrestis]
 gb|ASV47688.1| photosystem II protein M (chloroplast) [Circaeaster agrestis]
          Length = 34

 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 28/29 (96%), Positives = 28/29 (96%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKTVSQ N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTVSQKN 34


>ref|YP_009154945.1| photosystem II M protein (chloroplast) [Gentiana straminea]
 ref|YP_009155030.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 ref|YP_009155860.1| photosystem II protein M (plastid) [Stipa hymenoides]
 ref|YP_009156028.1| photosystem II protein M (plastid) [Ampelodesmos mauritanicus]
 ref|YP_009157112.1| photosystem II protein M (plastid) [Oryzopsis asperifolia]
 ref|YP_009157363.1| photosystem II protein M (plastid) [Phleum alpinum]
 ref|YP_009157447.1| photosystem II protein M (plastid) [Piptochaetium avenaceum]
 ref|YP_009175669.1| photosystem II protein M (chloroplast) [Eutrema salsugineum]
 ref|YP_009180558.1| photosystem II protein M (chloroplast) [Stipa lipskyi]
 ref|YP_009192782.1| photosystem II protein M (chloroplast) [Eutrema yunnanense]
 ref|YP_009192869.1| photosystem II protein M (chloroplast) [Eutrema heterophyllum]
 ref|YP_009232350.1| photosystem II protein M (chloroplast) [Eutrema halophilum]
 ref|YP_009232437.1| photosystem II protein M (chloroplast) [Eutrema botschantzevii]
 ref|YP_009232648.1| photosystem II protein M (chloroplast) [Stipa purpurea]
 ref|YP_009256989.1| photosystem II protein M (chloroplast) [Gentiana tibetica]
 ref|YP_009330685.1| photosystem II protein M (chloroplast) [Viburnum utile]
 ref|YP_009356347.1| photosystem II protein M (chloroplast) [Thlaspi arvense]
 ref|YP_009420152.1| photosystem II M protein (chloroplast) [Gentiana macrophylla]
 ref|YP_009451673.1| photosystem II protein M (chloroplast) [Nardus stricta]
 ref|YP_009451757.1| photosystem II protein M (chloroplast) [Nassella hyalina]
 ref|YP_009452014.1| photosystem II protein M (chloroplast) [Piptatherum songaricum]
 ref|YP_009464227.1| photosystem II protein M (plastid) [Stipa arabica]
 ref|YP_009464308.1| photosystem II protein M (plastid) [Stipa borysthenica]
 ref|YP_009464389.1| photosystem II protein M (plastid) [Stipa capillata]
 ref|YP_009464470.1| photosystem II protein M (plastid) [Stipa caucasica]
 ref|YP_009464551.1| photosystem II protein M (plastid) [Stipa hohenackeriana]
 ref|YP_009464632.1| photosystem II protein M (plastid) [Stipa jagnobica]
 ref|YP_009464713.1| photosystem II protein M (plastid) [Stipa lessingiana]
 ref|YP_009464794.1| photosystem II protein M (plastid) [Stipa magnifica]
 ref|YP_009464875.1| photosystem II protein M (plastid) [Stipa narynica]
 ref|YP_009464956.1| photosystem II protein M (plastid) [Stipa orientalis]
 ref|YP_009465037.1| photosystem II protein M (plastid) [Stipa ovczinnikovii]
 ref|YP_009465118.1| photosystem II protein M (plastid) [Stipa x alaica]
 ref|YP_009465199.1| photosystem II protein M (plastid) [Stipa x brevicallosa]
 ref|YP_009465280.1| photosystem II protein M (plastid) [Stipa zalesskii]
 ref|YP_009467924.1| photosystem II protein M (chloroplast) [Alopecurus arundinaceus]
 gb|AID57319.1| photosystem II M protein (chloroplast) [Gentiana straminea]
 gb|AID61129.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|AJV88767.1| photosystem II protein M (plastid) [Stipa hymenoides]
 gb|AJV88935.1| photosystem II protein M (plastid) [Ampelodesmos mauritanicus]
 gb|AJV90019.1| photosystem II protein M (plastid) [Oryzopsis asperifolia]
 gb|AJV90270.1| photosystem II protein M (plastid) [Phleum alpinum]
 gb|AJV90354.1| photosystem II protein M (plastid) [Piptochaetium avenaceum]
 gb|AKZ31612.1| cytochrome b6/f complex subunit VIII (chloroplast) [Gentiana
           robusta]
 gb|ALH16832.1| photosystem II protein M (chloroplast) [Eutrema salsugineum]
 gb|ALM03049.1| photosystem II protein M (chloroplast) [Stipa lipskyi]
 gb|ALP73209.1| photosystem II protein M (chloroplast) [Eutrema yunnanense]
 gb|ALP73286.1| photosystem II protein M (chloroplast) [Eutrema heterophyllum]
 gb|AMA21337.1| photosystem II protein M (chloroplast) [Eutrema halophilum]
 gb|AMA21424.1| photosystem II protein M (chloroplast) [Eutrema botschantzevii]
 gb|AMA97165.1| photosystem II protein M (chloroplast) [Stipa purpurea]
 gb|AMC31875.1| photosystem II protein M (chloroplast) [Chorispora tenella]
 gb|ANG07638.1| photosystem II protein M (chloroplast) [Gentiana tibetica]
 gb|APD79287.1| photosystem II protein M (chloroplast) [Viburnum utile]
 gb|AQV10435.1| photosystem II protein M (chloroplast) [Thlaspi arvense]
 gb|ARQ27987.1| photosystem II protein M (chloroplast) [Nardus stricta]
 gb|ARQ28071.1| photosystem II protein M (chloroplast) [Nassella hyalina]
 gb|ARQ28328.1| photosystem II protein M (chloroplast) [Piptatherum songaricum]
 gb|ARS43980.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44420.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44505.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44590.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44675.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44760.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44845.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARS44930.1| photosystem II M protein (chloroplast) [Gentiana crassicaulis]
 gb|ARU80785.1| photosystem II protein M (chloroplast) [Agropyron cristatum]
 gb|ASD39635.1| photosystem II protein M (chloroplast) [Agropyron cristatum]
 gb|ASD39788.1| photosystem II protein M (chloroplast) [Agropyron cristatum]
 gb|ASD40401.1| photosystem II protein M (chloroplast) [Australopyrum retrofractum]
 gb|ASD41237.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis]
 gb|ASD41313.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis]
 gb|ASD41389.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis]
 gb|ASD41465.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis]
 gb|ASD41541.1| photosystem II protein M (chloroplast) [Eremopyrum bonaepartis]
 gb|ASD41617.1| photosystem II protein M (chloroplast) [Eremopyrum triticeum]
 gb|ASD41693.1| photosystem II protein M (chloroplast) [Eremopyrum triticeum]
 gb|ASD41757.1| photosystem II protein M (chloroplast) [Eremopyrum triticeum]
 gb|ASD41844.1| photosystem II protein M (chloroplast) [Henrardia persica]
 gb|ASD41922.1| photosystem II protein M (chloroplast) [Henrardia persica]
 gb|ASD42079.1| photosystem II protein M (chloroplast) [Henrardia persica]
 gb|ASI00078.1| photosystem II protein M (chloroplast) [Agropyron cristatum]
 gb|ASI01001.1| photosystem II protein M (chloroplast) [Australopyrum retrofractum]
 gb|ASJ64634.1| photosystem II protein M (chloroplast) [Chorispora tenella]
 gb|ASO75683.1| photosystem II M protein (chloroplast) [Gentiana macrophylla]
 gb|ATL15497.1| photosystem II protein M (chloroplast) [Nassella neesiana]
 gb|ATL15581.1| photosystem II protein M (chloroplast) [Nassella hyalina]
 gb|AUZ21122.1| photosystem II protein M (plastid) [Stipa arabica]
 gb|AUZ21203.1| photosystem II protein M (plastid) [Stipa borysthenica]
 gb|AUZ21284.1| photosystem II protein M (plastid) [Stipa capillata]
 gb|AUZ21365.1| photosystem II protein M (plastid) [Stipa capillata]
 gb|AUZ21446.1| photosystem II protein M (plastid) [Stipa caucasica]
 gb|AUZ21527.1| photosystem II protein M (plastid) [Stipa caucasica]
 gb|AUZ21608.1| photosystem II protein M (plastid) [Stipa caucasica subsp.
           glareosa]
 gb|AUZ21689.1| photosystem II protein M (plastid) [Stipa hohenackeriana]
 gb|AUZ21770.1| photosystem II protein M (plastid) [Stipa jagnobica]
 gb|AUZ21851.1| photosystem II protein M (plastid) [Stipa lessingiana]
 gb|AUZ21932.1| photosystem II protein M (plastid) [Stipa magnifica]
 gb|AUZ22013.1| photosystem II protein M (plastid) [Stipa narynica]
 gb|AUZ22094.1| photosystem II protein M (plastid) [Stipa orientalis]
 gb|AUZ22175.1| photosystem II protein M (plastid) [Stipa ovczinnikovii]
 gb|AUZ22256.1| photosystem II protein M (plastid) [Stipa pennata subsp. ceynowae]
 gb|AUZ22337.1| photosystem II protein M (plastid) [Stipa pennata subsp. pennata]
 gb|AUZ22418.1| photosystem II protein M (plastid) [Stipa richteriana subsp.
           richteriana]
 gb|AUZ22498.1| photosystem II protein M (plastid) [Stipa tianschanica var. gobica]
 gb|AUZ22579.1| photosystem II protein M (plastid) [Stipa x alaica]
 gb|AUZ22660.1| photosystem II protein M (plastid) [Stipa x brevicallosa]
 gb|AUZ22741.1| photosystem II protein M (plastid) [Stipa zalesskii]
 gb|AVA08201.1| photosystem II protein M (chloroplast) [Alopecurus arundinaceus]
          Length = 34

 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 27/29 (93%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFIL+PTAFLLIIYVKTVSQ+N
Sbjct: 6   LAFIATALFILIPTAFLLIIYVKTVSQNN 34


>ref|YP_009136595.1| photosystem II reaction center M protein (plastid) [Viola
           seoulensis]
 gb|AKE07199.1| photosystem II reaction center M protein (plastid) [Viola
           seoulensis]
 gb|AMC31898.1| photosystem II protein M (chloroplast) [Viola bicolor]
          Length = 34

 Score = 55.1 bits (131), Expect = 5e-07
 Identities = 27/29 (93%), Positives = 29/29 (100%)
 Frame = -2

Query: 464 LAFIATALFILVPTAFLLIIYVKTVSQSN 378
           LAFIATALFILVPTAFLLIIYVKT+SQ+N
Sbjct: 6   LAFIATALFILVPTAFLLIIYVKTISQTN 34


Top