BLASTX nr result
ID: Astragalus22_contig00021668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Astragalus22_contig00021668 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU44038.1| hypothetical protein TSUD_349700 [Trifolium subt... 86 1e-16 gb|PNY08388.1| cytochrome p450 86a2-like protein [Trifolium prat... 86 2e-16 ref|XP_003627566.1| cytochrome P450 family 94 protein [Medicago ... 86 2e-16 ref|XP_021906236.1| cytochrome P450 86A8-like, partial [Carica p... 84 4e-16 ref|XP_019432999.1| PREDICTED: cytochrome P450 86A8 [Lupinus ang... 84 4e-16 gb|EEF50544.1| cytochrome P450, putative [Ricinus communis] 83 1e-15 ref|XP_015584331.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P... 83 1e-15 gb|ACO87292.1| LACERATA, partial [Arabidopsis thaliana] 76 2e-15 gb|PRQ58131.1| putative unspecific monooxygenase [Rosa chinensis] 82 3e-15 ref|XP_004510774.1| PREDICTED: cytochrome P450 86A8 [Cicer ariet... 82 3e-15 gb|OAY49149.1| hypothetical protein MANES_05G033400 [Manihot esc... 82 3e-15 ref|XP_021612097.1| cytochrome P450 86A8-like [Manihot esculenta] 82 3e-15 ref|XP_024175758.1| cytochrome P450 86A8-like [Rosa chinensis] 82 3e-15 ref|XP_004306772.1| PREDICTED: cytochrome P450 86A8-like [Fragar... 82 3e-15 ref|XP_021673951.1| cytochrome P450 86A8-like [Hevea brasiliensis] 82 3e-15 ref|XP_010087951.1| cytochrome P450 86A8 [Morus notabilis] >gi|5... 82 3e-15 gb|OMP00415.1| Cytochrome P450 [Corchorus olitorius] 81 3e-15 ref|XP_019430052.1| PREDICTED: cytochrome P450 86A8-like [Lupinu... 81 5e-15 gb|PPS15609.1| hypothetical protein GOBAR_AA05003 [Gossypium bar... 81 7e-15 ref|XP_017630789.1| PREDICTED: cytochrome P450 86A8-like [Gossyp... 81 7e-15 >dbj|GAU44038.1| hypothetical protein TSUD_349700 [Trifolium subterraneum] Length = 407 Score = 85.5 bits (210), Expect = 1e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 54 >gb|PNY08388.1| cytochrome p450 86a2-like protein [Trifolium pratense] Length = 540 Score = 85.5 bits (210), Expect = 2e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 54 >ref|XP_003627566.1| cytochrome P450 family 94 protein [Medicago truncatula] gb|AET02042.1| cytochrome P450 family 94 protein [Medicago truncatula] Length = 540 Score = 85.5 bits (210), Expect = 2e-16 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 54 >ref|XP_021906236.1| cytochrome P450 86A8-like, partial [Carica papaya] Length = 512 Score = 84.3 bits (207), Expect = 4e-16 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSLRGPRVWPLLGSLPGLIENC+RMHDWIC Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWIC 54 >ref|XP_019432999.1| PREDICTED: cytochrome P450 86A8 [Lupinus angustifolius] ref|XP_019433000.1| PREDICTED: cytochrome P450 86A8 [Lupinus angustifolius] gb|OIW21422.1| hypothetical protein TanjilG_03456 [Lupinus angustifolius] Length = 541 Score = 84.3 bits (207), Expect = 4e-16 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENCERMHDWIC Sbjct: 19 WFTFISRSLKGPRVWPLLGSLPGLIENCERMHDWIC 54 >gb|EEF50544.1| cytochrome P450, putative [Ricinus communis] Length = 522 Score = 83.2 bits (204), Expect = 1e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+RMHDWIC Sbjct: 26 WFTFISRSLKGPRVWPLLGSLPGLIENCDRMHDWIC 61 >ref|XP_015584331.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 86A8 [Ricinus communis] Length = 559 Score = 83.2 bits (204), Expect = 1e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+RMHDWIC Sbjct: 26 WFTFISRSLKGPRVWPLLGSLPGLIENCDRMHDWIC 61 >gb|ACO87292.1| LACERATA, partial [Arabidopsis thaliana] Length = 66 Score = 75.9 bits (185), Expect = 2e-15 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI 6 W TFISR L+GPRVWP+LGSLPGLIENCERMHDWI Sbjct: 19 WLTFISRCLKGPRVWPILGSLPGLIENCERMHDWI 53 >gb|PRQ58131.1| putative unspecific monooxygenase [Rosa chinensis] Length = 527 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+R+HDWIC Sbjct: 19 WFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWIC 54 >ref|XP_004510774.1| PREDICTED: cytochrome P450 86A8 [Cicer arietinum] Length = 539 Score = 82.0 bits (201), Expect = 3e-15 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI 6 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI 53 >gb|OAY49149.1| hypothetical protein MANES_05G033400 [Manihot esculenta] Length = 542 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+R+HDWIC Sbjct: 19 WFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWIC 54 >ref|XP_021612097.1| cytochrome P450 86A8-like [Manihot esculenta] Length = 546 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+R+HDWIC Sbjct: 23 WFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWIC 58 >ref|XP_024175758.1| cytochrome P450 86A8-like [Rosa chinensis] Length = 552 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+R+HDWIC Sbjct: 19 WFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWIC 54 >ref|XP_004306772.1| PREDICTED: cytochrome P450 86A8-like [Fragaria vesca subsp. vesca] Length = 553 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+R+HDWIC Sbjct: 19 WFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWIC 54 >ref|XP_021673951.1| cytochrome P450 86A8-like [Hevea brasiliensis] Length = 555 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISRSL+GPRVWPLLGSLPGLIENC+R+HDWIC Sbjct: 19 WFTFISRSLKGPRVWPLLGSLPGLIENCDRLHDWIC 54 >ref|XP_010087951.1| cytochrome P450 86A8 [Morus notabilis] gb|EXB30873.1| Cytochrome P450 86A2 [Morus notabilis] Length = 556 Score = 82.0 bits (201), Expect = 3e-15 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFTFISR+L+GPRVWPLLGSLPGLIENC+RMHDWIC Sbjct: 19 WFTFISRTLKGPRVWPLLGSLPGLIENCDRMHDWIC 54 >gb|OMP00415.1| Cytochrome P450 [Corchorus olitorius] Length = 313 Score = 80.9 bits (198), Expect = 3e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI 6 WFTFISRSLRGPRVWPLLGSLPGLIENC+RMHDWI Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWI 53 >ref|XP_019430052.1| PREDICTED: cytochrome P450 86A8-like [Lupinus angustifolius] gb|OIW19913.1| hypothetical protein TanjilG_28892 [Lupinus angustifolius] Length = 541 Score = 81.3 bits (199), Expect = 5e-15 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWIC 3 WFT ISRSLRGPRVWPLLGSLPGLIENC+RMHDWIC Sbjct: 19 WFTCISRSLRGPRVWPLLGSLPGLIENCDRMHDWIC 54 >gb|PPS15609.1| hypothetical protein GOBAR_AA05003 [Gossypium barbadense] Length = 528 Score = 80.9 bits (198), Expect = 7e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI 6 WFTFISRSLRGPRVWPLLGSLPGLIENC+RMHDWI Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWI 53 >ref|XP_017630789.1| PREDICTED: cytochrome P450 86A8-like [Gossypium arboreum] Length = 528 Score = 80.9 bits (198), Expect = 7e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -2 Query: 110 WFTFISRSLRGPRVWPLLGSLPGLIENCERMHDWI 6 WFTFISRSLRGPRVWPLLGSLPGLIENC+RMHDWI Sbjct: 19 WFTFISRSLRGPRVWPLLGSLPGLIENCDRMHDWI 53